PITX3 Antibody


Western Blot: PITX3 Antibody [NBP2-85481] - Host: Rabbit. Target Name: PITX3. Sample Type: 293T. Antibody Dilution: 1.0ug/mlPITX3 is supported by BioGPS gene expression data to be expressed in HEK293T
Western Blot: PITX3 Antibody [NBP2-85481] - WB Suggested Anti-PITX3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: MCF7 cell lysate
Western Blot: PITX3 Antibody [NBP2-85481] - Host: Rabbit. Target Name: PITX3. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC
0.5 mg/ml

Order Details

PITX3 Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of human PITX3. Peptide sequence: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for PITX3 Antibody

  • CTPP4
  • Homeobox protein PITX3
  • MGC12766
  • paired-like homeodomain 3
  • Paired-like homeodomain transcription factor 3
  • pituitary homeobox 3
  • PTX3


PITX3 encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: Simple Western, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: BA
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB

Publications for PITX3 Antibody (NBP2-85481) (0)

There are no publications for PITX3 Antibody (NBP2-85481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITX3 Antibody (NBP2-85481) (0)

There are no reviews for PITX3 Antibody (NBP2-85481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PITX3 Antibody (NBP2-85481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PITX3 Products

Array NBP2-85481

Diseases for PITX3 Antibody (NBP2-85481)

Discover more about diseases related to PITX3 Antibody (NBP2-85481).

Pathways for PITX3 Antibody (NBP2-85481)

View related products by pathway.

PTMs for PITX3 Antibody (NBP2-85481)

Learn more about PTMs related to PITX3 Antibody (NBP2-85481).

Research Areas for PITX3 Antibody (NBP2-85481)

Find related products by research area.

Blogs on PITX3

There are no specific blogs for PITX3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PITX3 Antibody and receive a gift card or discount.


Gene Symbol PITX3