PITX3 Antibody

Images

 
Western Blot: PITX3 Antibody [NBP2-85481] - Host: Rabbit. Target Name: PITX3. Sample Type: 293T. Antibody Dilution: 1.0ug/mlPITX3 is supported by BioGPS gene expression data to be expressed in HEK293T
Western Blot: PITX3 Antibody [NBP2-85481] - WB Suggested Anti-PITX3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: MCF7 cell lysate
Western Blot: PITX3 Antibody [NBP2-85481] - Host: Rabbit. Target Name: PITX3. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PITX3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human PITX3. Peptide sequence: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PITX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PITX3 Antibody

  • CTPP4
  • Homeobox protein PITX3
  • MGC12766
  • paired-like homeodomain 3
  • Paired-like homeodomain transcription factor 3
  • pituitary homeobox 3
  • PTX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2558
Species: Hu, Mu
Applications: Simple Western, WB
AF7388
Species: Hu
Applications: IHC
DCRP00
Species: Hu
Applications: ELISA
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
H00005307-M01
Species: Hu
Applications: ChIP, ELISA, IHC, IHC-P, IP, KD, S-ELISA, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
D6050
Species: Hu
Applications: ELISA
1845-SH/CF
Species: Hu
Applications: BA
233-FB/CF
Species: Hu
Applications: BA
423-F8
Species: Hu, Mu
Applications: BA
NBP2-41194
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
201-LB/CF
Species: Hu
Applications: BA
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
3218-ND/CF
Species: Hu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
NBP1-87492
Species: Hu
Applications: IHC, IHC-P, WB

Publications for PITX3 Antibody (NBP2-85481) (0)

There are no publications for PITX3 Antibody (NBP2-85481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITX3 Antibody (NBP2-85481) (0)

There are no reviews for PITX3 Antibody (NBP2-85481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PITX3 Antibody (NBP2-85481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PITX3 Products

Bioinformatics Tool for PITX3 Antibody (NBP2-85481)

Discover related pathways, diseases and genes to PITX3 Antibody (NBP2-85481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITX3 Antibody (NBP2-85481)

Discover more about diseases related to PITX3 Antibody (NBP2-85481).
 

Pathways for PITX3 Antibody (NBP2-85481)

View related products by pathway.

PTMs for PITX3 Antibody (NBP2-85481)

Learn more about PTMs related to PITX3 Antibody (NBP2-85481).
 

Research Areas for PITX3 Antibody (NBP2-85481)

Find related products by research area.

Blogs on PITX3

There are no specific blogs for PITX3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PITX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PITX3