PIK3CA Antibody - BSA Free

Western Blot: PIK3CA Antibody [NBP3-35708] - Western Blot analysis of extracts of 293T cells, using PIK3CA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIK3CA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PIK3CA Antibody - BSA Free (NBP3-35708) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 401-600 of human PIK3CA (NP_006209.2).
  
  Sequence:
  ERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIK3CA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 124 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PIK3CA Antibody - BSA Free

• CLAPO
• CLOVE
• CWS5
• EC 2.7.1
• EC 2.7.1.153
• MCMTC
• MGC142161
• MGC142163
• P110alpha
• p110-alpha
• Phosphatidylinositol 3-Kinase catalytic subunit alpha
• phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha
• phosphatidylinositol 3-kinase, catalytic, alpha polypeptide
• Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha
• phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
• phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, alpha isoform
• phosphoinositide-3-kinase, catalytic, alpha polypeptide
• PI3K
• PI3Kalpha
• PI3K-alpha
• PI3-kinase p110 subunit alpha
• PI3-kinase subunit alpha
• PIK3CA
• PtdIns-3-kinase p110
• PtdIns-3-kinase subunit alpha
• PtdIns-3-kinase subunit p110-alpha

Background

PI3-Kinases (PI3-Ks) are a family of lipid kinases that are implicated in signal transduction. PI3-K consists of two subunits; p85 and p10. The p85 subunit localize PI3-K activity to the plasma membrane while the p110 subunit contains the catalytic domain of PI3-K (1-2). Four isoforms of p110 has been found;

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIK3CA