PIGU Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PIGU Antibody [NBP2-30691] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: PIGU Antibody [NBP2-30691] - Staining of human stomach, upper shows strong luminal membranous positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIGU Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PIGU Antibody - BSA Free (NBP2-30691) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPL
• Predicted Species: Mouse (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIGU
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PIGU Protein (NBP2-30691PEP)

Reactivity Notes

Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PIGU Antibody - BSA Free

• bA346K17.2
• CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1
• CDC91L1CDC91 cell division cycle 91-like 1 (S. cerevisiae)
• cell division cycle 91-like 1 protein
• Cell division cycle protein 91-like 1
• GAB1
• GPI transamidase component PIG-U
• GPI transamidase subunit
• MGC40420
• phosphatidylinositol glycan anchor biosynthesis class U protein
• phosphatidylinositol glycan anchor biosynthesis, class U
• Protein CDC91-like 1

Background

CDC91L1 - CDC91 cell division cycle 91-like 1 (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIGU
• Uniprot:
  • Q9H490(Human)