PI 3-Kinase p55 gamma Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PIK3R3 Antibody [NBP2-57974] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PI 3-Kinase p55 gamma Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD
Specificity
Specificity of human PIK3R3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIK3R3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PI 3-Kinase p55 gamma Antibody

  • DKFZp686P05226
  • FLJ41892
  • p55
  • p55-GAMMA
  • p55PIK
  • Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma
  • phosphatidylinositol 3-kinase regulatory subunit gamma
  • phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 3 (p55, gamma)
  • phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
  • PI 3Kinase p55 gamma
  • PI 3-Kinase p55 gamma
  • PI3K regulatory subunit gamma
  • PI3-kinase regulatory subunit gamma
  • PI3-kinase subunit p55-gamma
  • PIK3R3
  • PtdIns-3-kinase regulatory subunit gamma
  • ptdIns-3-kinase regulatory subunit p55-gamma
  • regulatory subunit, polypeptide 3 (p55, gamma)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB3468
Species: Hu
Applications: WB, ICC
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-34031
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57974
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PI 3-Kinase p55 gamma Antibody (NBP2-57974) (0)

There are no publications for PI 3-Kinase p55 gamma Antibody (NBP2-57974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p55 gamma Antibody (NBP2-57974) (0)

There are no reviews for PI 3-Kinase p55 gamma Antibody (NBP2-57974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PI 3-Kinase p55 gamma Antibody (NBP2-57974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PI 3-Kinase p55 gamma Products

Bioinformatics Tool for PI 3-Kinase p55 gamma Antibody (NBP2-57974)

Discover related pathways, diseases and genes to PI 3-Kinase p55 gamma Antibody (NBP2-57974). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI 3-Kinase p55 gamma Antibody (NBP2-57974)

Discover more about diseases related to PI 3-Kinase p55 gamma Antibody (NBP2-57974).
 

Pathways for PI 3-Kinase p55 gamma Antibody (NBP2-57974)

View related products by pathway.

PTMs for PI 3-Kinase p55 gamma Antibody (NBP2-57974)

Learn more about PTMs related to PI 3-Kinase p55 gamma Antibody (NBP2-57974).
 

Research Areas for PI 3-Kinase p55 gamma Antibody (NBP2-57974)

Find related products by research area.

Blogs on PI 3-Kinase p55 gamma

There are no specific blogs for PI 3-Kinase p55 gamma, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PI 3-Kinase p55 gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R3