PI 3-Kinase p55 gamma Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: PIK3R3 Antibody [NBP2-57974] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

PI 3-Kinase p55 gamma Antibody - BSA Free Summary

Immunogen
PI 3-Kinase p55 gamma Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIK3R3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PI 3-Kinase p55 gamma Recombinant Protein Antigen (NBP2-57974PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PI 3-Kinase p55 gamma Antibody - BSA Free

  • DKFZp686P05226
  • FLJ41892
  • p55
  • p55-GAMMA
  • p55PIK
  • Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma
  • phosphatidylinositol 3-kinase regulatory subunit gamma
  • phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 3 (p55, gamma)
  • phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
  • PI 3Kinase p55 gamma
  • PI 3-Kinase p55 gamma
  • PI3K regulatory subunit gamma
  • PI3-kinase regulatory subunit gamma
  • PI3-kinase subunit p55-gamma
  • PIK3R3
  • PtdIns-3-kinase regulatory subunit gamma
  • ptdIns-3-kinase regulatory subunit p55-gamma
  • regulatory subunit, polypeptide 3 (p55, gamma)

Background

PI 3-Kinase p55 gamma, also referred to as PI3Kp55 gamma or p55gamma, is a regulatory subunit of phosphatidylinositol 3-kinase (PI 3-Kinase / PI3K) (1). Class 1A PI 3-Kinases are heterodimers consisting of one 110 kDa catalytic subunit (p110 alpha, beta, or delta) and one regulatory subunit (p85 alpha, p85 beta, p55 alpha, p50 alpha, or p55 gamma) (1). The p55 gamma regulatory subunit is encoded by the PIK3R3 gene and is predominantly expressed in the brain (2). Human PI 3 Kinase p55 gamma protein is 461 amino acids (aa) in length with a theoretical molecular weight of ~54 kDa (3). Structurally, PI 3-Kinase p55 gamma contains a proline rich domain (aa 34 - 44) and two Src homology domains (SH2, aa 65 - 160 and 358 - 452) (1,3). In general, Class 1A PI 3-Kinases are activated through the binding of membrane-bound tyrosine kinase receptors, such as insulin-like growth factor 1 (IGF-1) (1,2,4). Activation of PI 3-Kinase results in the phosphorylation of phosphatidyl inositol and a downstream signaling cascade of the AKT/mTOR pathway (2,4). PI 3-Kinase pathway activation results in a number of cellular responses including proliferation, survival, growth, migration, membrane trafficking, and metabolism (2). The PI3-Kinase/AKT/mTOR pathway has been shown to be dysregulated in a number of cancers, largely through loss or inactivation of the tumor suppressor PTEN (4). Furthermore, one study found that anaplastic lymphoma kinase (ALK) promoted cell migration during brain development specifically through the p55 gamma regulatory subunit of PI 3-Kinase (5).

References

1. Backer J. M. (2010). The regulation of class IA PI 3-kinases by inter-subunit interactions. Current Topics in Microbiology and Immunology. https://doi.org/10.1007/82_2010_52

2. Hirsch, E., Costa, C., & Ciraolo, E. (2007). Phosphoinositide 3-kinases as a common platform for multi-hormone signaling. The Journal of Endocrinology. https://doi.org/10.1677/JOE-07-0097

3. Uniprot (Q92569)

4. Yang, J., Nie, J., Ma, X., Wei, Y., Peng, Y., & Wei, X. (2019). Targeting PI3K in cancer: mechanisms and advances in clinical trials. Molecular Cancer. https://doi.org/10.1186/s12943-019-0954-x

5. Seo, M., Kim, J. H., & Suk, K. (2017). Role of the p55-gamma subunit of PI3K in ALK-induced cell migration: RNAi-based selection of cell migration regulators. Cell Adhesion & Migration. https://doi.org/10.1080/19336918.2016.1202385

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

202-IL
Species: Hu
Applications: BA
DRT200
Species: Hu
Applications: ELISA
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
AF3468
Species: Hu
Applications: ICC, KO, Simple Western, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
DRT100
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
201-LB
Species: Hu
Applications: BA
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-57974
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PI 3-Kinase p55 gamma Antibody (NBP2-57974) (0)

There are no publications for PI 3-Kinase p55 gamma Antibody (NBP2-57974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p55 gamma Antibody (NBP2-57974) (0)

There are no reviews for PI 3-Kinase p55 gamma Antibody (NBP2-57974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PI 3-Kinase p55 gamma Antibody (NBP2-57974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PI 3-Kinase p55 gamma Products

Research Areas for PI 3-Kinase p55 gamma Antibody (NBP2-57974)

Find related products by research area.

Blogs on PI 3-Kinase p55 gamma

There are no specific blogs for PI 3-Kinase p55 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PI 3-Kinase p55 gamma Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R3