PI 3-Kinase p55 gamma Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
PI 3-Kinase p55 gamma Antibody is made to synthetic peptides corresponding to PIK3R3(phosphoinositide-3-kinase, regulatory subunit 3 (gamma)) The peptide sequence was selected from the middle region of PIK3R3. Peptide sequence EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE. The peptide sequence for this immunogen was taken from within the described region. |
| Specificity |
PI 3-Kinase p55 gamma Antibody is specific to Subunit or Isoform: gamma. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PIK3R3 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for PI 3-Kinase p55 gamma Antibody - BSA Free
Background
PI 3-Kinase p55 gamma, also referred to as PI3Kp55 gamma or p55gamma, is a regulatory subunit of phosphatidylinositol 3-kinase (PI 3-Kinase / PI3K) (1). Class 1A PI 3-Kinases are heterodimers consisting of one 110 kDa catalytic subunit (p110 alpha, beta, or delta) and one regulatory subunit (p85 alpha, p85 beta, p55 alpha, p50 alpha, or p55 gamma) (1). The p55 gamma regulatory subunit is encoded by the PIK3R3 gene and is predominantly expressed in the brain (2). Human PI 3 Kinase p55 gamma protein is 461 amino acids (aa) in length with a theoretical molecular weight of ~54 kDa (3). Structurally, PI 3-Kinase p55 gamma contains a proline rich domain (aa 34 - 44) and two Src homology domains (SH2, aa 65 - 160 and 358 - 452) (1,3). In general, Class 1A PI 3-Kinases are activated through the binding of membrane-bound tyrosine kinase receptors, such as insulin-like growth factor 1 (IGF-1) (1,2,4). Activation of PI 3-Kinase results in the phosphorylation of phosphatidyl inositol and a downstream signaling cascade of the AKT/mTOR pathway (2,4). PI 3-Kinase pathway activation results in a number of cellular responses including proliferation, survival, growth, migration, membrane trafficking, and metabolism (2). The PI3-Kinase/AKT/mTOR pathway has been shown to be dysregulated in a number of cancers, largely through loss or inactivation of the tumor suppressor PTEN (4). Furthermore, one study found that anaplastic lymphoma kinase (ALK) promoted cell migration during brain development specifically through the p55 gamma regulatory subunit of PI 3-Kinase (5).
References
1. Backer J. M. (2010). The regulation of class IA PI 3-kinases by inter-subunit interactions. Current Topics in Microbiology and Immunology. https://doi.org/10.1007/82_2010_52
2. Hirsch, E., Costa, C., & Ciraolo, E. (2007). Phosphoinositide 3-kinases as a common platform for multi-hormone signaling. The Journal of Endocrinology. https://doi.org/10.1677/JOE-07-0097
3. Uniprot (Q92569)
4. Yang, J., Nie, J., Ma, X., Wei, Y., Peng, Y., & Wei, X. (2019). Targeting PI3K in cancer: mechanisms and advances in clinical trials. Molecular Cancer. https://doi.org/10.1186/s12943-019-0954-x
5. Seo, M., Kim, J. H., & Suk, K. (2017). Role of the p55-gamma subunit of PI3K in ALK-induced cell migration: RNAi-based selection of cell migration regulators. Cell Adhesion & Migration. https://doi.org/10.1080/19336918.2016.1202385
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for PI 3-Kinase p55 gamma Antibody (NBP1-58332) (0)
There are no publications for PI 3-Kinase p55 gamma Antibody (NBP1-58332).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PI 3-Kinase p55 gamma Antibody (NBP1-58332) (0)
There are no reviews for PI 3-Kinase p55 gamma Antibody (NBP1-58332).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PI 3-Kinase p55 gamma Antibody (NBP1-58332) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PI 3-Kinase p55 gamma Products
Research Areas for PI 3-Kinase p55 gamma Antibody (NBP1-58332)
Find related products by research area.
|
Blogs on PI 3-Kinase p55 gamma