PHF6 Antibody - BSA Free

Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining in human epididymis and liver tissues using anti-PHF6 antibody. Corresponding PHF6 RNA-seq data are presented for the same tissues.

Western Blot: PHF6 Antibody [NBP1-88646] - Analysis in human cell line EFO-21.

Immunocytochemistry/Immunofluorescence: PHF6 Antibody [NBP1-88646] - Staining of human cell line U-251MG shows positivity in nucleus and nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining of human epididymis shows high expression.

Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining of human cerebral cortex shows moderate nuclear and nucleolar positivity in neurons.

Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining of human testis shows strong nuclear positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PHF6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PHF6 Antibody - BSA Free (NBP1-88646) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PHF6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 -1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PHF6 Protein (NBP1-88646PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PHF6 Antibody - BSA Free

• BFLS
• BORJ
• Borjeson-Forssman-Lehmann syndrome
• KIAA1823
• MGC14797
• PHD finger protein 6
• PHD-like zinc finger protein

Background

PHF6 is a member of the plant homeodomain (PHD)-like finger (PHF) family. It encodes a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation, that localizes to the nucleolus. Mutations affecting the coding region of this gene or the splicing of the transcript have been associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a disorder characterized by mental retardation, epilepsy, hypogonadism, hypometabolism, obesity, swelling of subcutaneous tissue of the face, narrow palpebral fissures, and large ears. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHF6 Antibody (NBP1-88646)(1)

Publication using NBP1-88646

• Ponten F, Jirstrom K, Uhlen M. The Human Protein Atlas--a tool for pathology. J Pathol 2008-12-01 [PMID: 18853439]

Bioinformatics

• Gene Symbol: PHF6