PHF6 Antibody

Images

 
Western Blot: PHF6 Antibody [NBP1-88646] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: PHF6 Antibody [NBP1-88646] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: PHF6 Antibody [NBP1-88646] - Staining of human ovary shows strong nuclear positivity in follicle and ovarian stroma cells.
Western Blot: PHF6 Antibody [NBP1-88646] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-433
Immunocytochemistry/ Immunofluorescence: PHF6 Antibody [NBP1-88646] - Staining of human cell line U-251MG shows positivity in nucleus and nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHF6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHF6 Protein (NBP1-88646PEP)
Publications
Read Publication using NBP1-88646.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF6 Antibody

  • BFLS
  • BORJ
  • Borjeson-Forssman-Lehmann syndrome
  • KIAA1823
  • MGC14797
  • PHD finger protein 6
  • PHD-like zinc finger protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-89124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-57521
Species: Hu, Mu
Applications: WB, IP
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
640-A3
Species: Mu
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt

Publications for PHF6 Antibody (NBP1-88646)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-88646 Applications Species
Ponten F, Jirstrom K, Uhlen M et al. The Human Protein Atlas--a tool for pathology. J Pathol 2008 Dec [PMID: 18853439]

Reviews for PHF6 Antibody (NBP1-88646) (0)

There are no reviews for PHF6 Antibody (NBP1-88646). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHF6 Antibody (NBP1-88646) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF6 Products

Bioinformatics Tool for PHF6 Antibody (NBP1-88646)

Discover related pathways, diseases and genes to PHF6 Antibody (NBP1-88646). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF6 Antibody (NBP1-88646)

Discover more about diseases related to PHF6 Antibody (NBP1-88646).
 

Pathways for PHF6 Antibody (NBP1-88646)

View related products by pathway.

PTMs for PHF6 Antibody (NBP1-88646)

Learn more about PTMs related to PHF6 Antibody (NBP1-88646).

Blogs on PHF6

There are no specific blogs for PHF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF6