ARHGEF6 Antibody

Images

 
Western Blot: ARHGEF6 Antibody [NBP1-89124] - Analysis in human cell line HL-60.
Immunocytochemistry/ Immunofluorescence: ARHGEF6 Antibody [NBP1-89124] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human cerebral cortex shows very weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHS
Specificity
Specificity of human ARHGEF6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
87 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ARHGEF6 Protein (NBP1-89124PEP)
Publications
Read Publication using NBP1-89124.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%). Reactivity reported in scientific literature (PMID: 26177020)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF6 Antibody

  • alphaPIX
  • Alpha-Pix
  • COOL-2
  • COOL2alpha
  • KIAA0006Cool2
  • mental retardation, X-linked 46
  • MRX46
  • PAK-interacting exchange factor alpha
  • PIXA
  • Rac/Cdc42 guanine exchange factor (GEF) 6
  • Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
  • Rac/Cdc42 guanine nucleotide exchange factor 6
  • rho guanine nucleotide exchange factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46327
Species: Hu
Applications: WB, IHC
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37448
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-99205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20237
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARHGEF6 Antibody (NBP1-89124)(1)

Reviews for ARHGEF6 Antibody (NBP1-89124) (0)

There are no reviews for ARHGEF6 Antibody (NBP1-89124). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGEF6 Antibody (NBP1-89124) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARHGEF6 Products

Bioinformatics Tool for ARHGEF6 Antibody (NBP1-89124)

Discover related pathways, diseases and genes to ARHGEF6 Antibody (NBP1-89124). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF6 Antibody (NBP1-89124)

Discover more about diseases related to ARHGEF6 Antibody (NBP1-89124).
 

Pathways for ARHGEF6 Antibody (NBP1-89124)

View related products by pathway.

PTMs for ARHGEF6 Antibody (NBP1-89124)

Learn more about PTMs related to ARHGEF6 Antibody (NBP1-89124).
 

Research Areas for ARHGEF6 Antibody (NBP1-89124)

Find related products by research area.

Blogs on ARHGEF6

There are no specific blogs for ARHGEF6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF6
Entrez
Uniprot