Home » PHACS » PHACS Antibodies » PHACS Antibody (1D2)

PHACS Antibody (1D2)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PHACS Antibody (1D2) [H00084680-M02] - Analysis of PHACS expression in transfected 293T cell line by PHACS monoclonal antibody (M02), clone 1D2.Lane 1: PHACS transfected lysate(57.34 KDa).Lane 2: Non-transfected lysate.
Western Blot: PHACS Antibody (1D2) [H00084680-M02] - Analysis of PHACS expression in transfected 293T cell line by PHACS monoclonal antibody (M02), clone 1D2.Lane 1: PHACS transfected lysate(57.34 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: PHACS Antibody (1D2) [H00084680-M02] - Analysis of monoclonal antibody to PHACS on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PHACS Antibody (1D2) Summary

Immunogen
PHACS (NP_115981, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIIN
Specificity
PHACS - 1-aminocyclopropane-1-carboxylate synthase
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACCS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHACS Antibody (1D2)

  • 1-aminocyclopropane-1-carboxylate synthase homolog(Arabidopsis)(non-functional)
  • 1-aminocyclopropane-1-carboxylate synthase-like protein 1
  • PHACSACSACC synthase-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

C-Reactive
Protein/CRP [HRP]
DCRP00
(4 Reviews)
(117 Publications)
Species: Hu
Applications: ELISA
Serpin A5/Protein
C Inhibitor Antibody ...
MAB1266
HepG2 human hepatocellular carcinoma cell line was stained with Mouse Anti-Human Serpin A5 Monoclonal Antibody (Catalog # MAB1266, filled histogram) or isotype control antibody (MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (FC005). Staining was performed using our Staining Intracellular Molecules protocol.
(2 Publications)
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Acetyl CoA
synthetase Antibody
NBP1-90276
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human stomach shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human tonsil shows no positivity in lymphocytes as expected.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CSRP1 Antibody
AF5739
Western blot shows lysates of ME-180 human cervical epithelial carcinoma cell line, HT-2 mouse T cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human/Mouse/Rat CSRP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5739) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human CSRP1, CSRP2, CSRP3 (5 ng/lane) were included. A specific band for CSRP1 was detected at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
BMP-2
[Unconjugated]
355-BM/CF
Recombinant human/mouse/rat BMP-2 (355-BM/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 40-200 ng/mL.
(168 Publications)
Species: Hu, Mu, Rt
Applications: BA
MITF Antibody
(21D1418) - BSA Free
NB100-56561
Immunohistochemistry-Paraffin: MITF Antibody (21D1418) [NB100-56561] - Analysis of a FFPE tissue section of human skin using 1:200 dilution of MITF (21D1418) antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. General cytoplasmic staining appears enriched in melanocytes below the epidermis. Some nuclear reactivity is observed as well.
Immunocytochemistry/Immunofluorescence: MITF Antibody (21D1418) [NB100-56561] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MITF Antibody (21D1418) NB100-56561 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Cells were imaged using a 100X objective and digitally deconvolved.
Western Blot: MITF Antibody (21D1418) [NB100-56561] - Analysis of HeLa lysate (35ug per lane, RIPA buffer) using MiTF antibody (NB100-56561) at 0.1ug/ml. Band detected at ~60kDa. (Expected MW of 58.2kDa according to NP_937802.1).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
IL-6 [HRP]
D6050
(32 Reviews)
(605 Publications)
Species: Hu
Applications: ELISA
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(16 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
Acetyl-CoA
Carboxylase alpha/ACA ...
NBP3-15744
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Immunohistochemistry of paraffin-embedded rat kidney using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Immunohistochemistry of paraffin-embedded mouse testis using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Western blot analysis of extracts of various cell lines, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ACSL5 Antibody
NBP1-59645
Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate. Antibody at a concentration of 1 ug/mL.
Simple Western: ACSL5 Antibody [NBP1-59645] - Simple Western analysis of mouse liver lysate. Simple Western image submitted by a verified customer review.
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - IHC analysis of human skeletal muscle tissue. Antibody concentration of 4 - 8ug/mL.
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
CD40 Ligand/TNFSF5
[HRP]
DCDL40
(41 Publications)
Species: Hu
Applications: ELISA
ACSL1 Antibody
NBP1-89270
Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NBP1-89270] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney, liver, soft tissues and tonsil using Anti-ACSL1 antibody NBP1-89270 (A) shows similar protein distribution across tissues to independent antibody NBP1-89271 (B).
Western Blot: ACSL1 Antibody [NBP1-89270] - Analysis using Anti-ACSL1 antibody NBP1-89270 (A) shows similar pattern to independent antibody NBP1-89271 (B).
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Myeloperoxidase/MPO [B
DY3667
(6 Reviews)
(61 Publications)
Species: Mu
Applications: ELISA
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
(1 Review)
(22 Publications)
Species: Hu
Applications: ELISA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PHACS Antibody
(1D2)
H00084680-M02
PHACS Antibody (1D2)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for PHACS Antibody (H00084680-M02) (0)

There are no publications for PHACS Antibody (H00084680-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHACS Antibody (H00084680-M02) (0)

There are no reviews for PHACS Antibody (H00084680-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHACS Antibody (H00084680-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHACS Products

Bioinformatics Tool for PHACS Antibody (H00084680-M02)

Discover related pathways, diseases and genes to PHACS Antibody (H00084680-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHACS Antibody (H00084680-M02)

Discover more about diseases related to PHACS Antibody (H00084680-M02).
 

Pathways for PHACS Antibody (H00084680-M02)

View related products by pathway.

Blogs on PHACS

There are no specific blogs for PHACS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHACS Antibody (1D2) and receive a gift card or discount.


Bioinformatics

Gene Symbol ACCS
Entrez
OMIM
Uniprot