Home » PHACS » PHACS Research Products » PHACS Antibody (1D2)

PHACS Antibody (1D2)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PHACS Antibody (1D2) [H00084680-M02] - Analysis of PHACS expression in transfected 293T cell line by PHACS monoclonal antibody (M02), clone 1D2.Lane 1: PHACS transfected lysate(57.34 KDa).Lane 2: Non-transfected lysate.
Western Blot: PHACS Antibody (1D2) [H00084680-M02] - Analysis of PHACS expression in transfected 293T cell line by PHACS monoclonal antibody (M02), clone 1D2.Lane 1: PHACS transfected lysate(57.34 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: PHACS Antibody (1D2) [H00084680-M02] - Analysis of monoclonal antibody to PHACS on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PHACS Antibody (1D2) Summary

Immunogen
PHACS (NP_115981, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIIN
Specificity
PHACS - 1-aminocyclopropane-1-carboxylate synthase
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACCS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHACS Antibody (1D2)

  • 1-aminocyclopropane-1-carboxylate synthase homolog(Arabidopsis)(non-functional)
  • 1-aminocyclopropane-1-carboxylate synthase-like protein 1
  • PHACSACSACC synthase-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

C-Reactive
Protein/CRP [HRP]
DCRP00
(3 Reviews)
(83 Publications)
Species: Hu
Serpin A5/Protein
C Inhibitor Antibody ...
NBP2-01833
Western Blot: Serpin A5/Protein C Inhibitor Antibody (2D10) [NBP2-01833] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Protein C inhibitor (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Protein C inhibitor.
Immunocytochemistry/Immunofluorescence: Serpin A5/Protein C Inhibitor Antibody (OTI2D10) [NBP2-01833] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Protein C inhibitor.
Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody (2D10) [NBP2-01833] - Staining of paraffin-embedded Human tonsil using anti-Protein C inhibitor mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Acetyl CoA
synthetase Antibody
NBP1-90276
Western Blot: Acetyl CoA synthetase Antibody [NBP1-90276] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/Immunofluorescence: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human tonsil shows no positivity in lymphocytes as expected.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CSRP1 Antibody
AF5739
Western blot shows lysates of ME-180 human cervical epithelial carcinoma cell line, HT-2 mouse T cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human/Mouse/Rat CSRP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5739) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human CSRP1, CSRP2, CSRP3 (5 ng/lane) were included. A specific band for CSRP1 was detected at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
BMP-2
[Unconjugated]
355-BM
BMP-2 [Unconjugated]
(9 Reviews)
(153 Publications)
Species: Hu, Mu, Rt
MITF Antibody
(21D1418)
NB100-56561
Western Blot: MITF Antibody (21D1418) [NB100-56561] - Analysis of A375 lysate using MITF antibody at 4 ug/ml.
Immunocytochemistry/Immunofluorescence: MITF Antibody (21D1418) [NB100-56561] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MITF Antibody (21D1418) NB100-56561 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: MITF Antibody (21D1418) [NB100-56561] - Analysis of a FFPE tissue section of human skin using 1:200 dilution of MITF (21D1418) antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. General cytoplasmic staining appears enriched in melanocytes below the epidermis. Some nuclear reactivity is observed as well.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
IL-6 [HRP]
D6050
(25 Reviews)
(465 Publications)
Species: Hu
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(13 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
Acetyl-CoA
Carboxylase alpha/ACA ...
NBP2-89114
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Staining Acetyl CoA Carboxylase 1 (ACC1) in SiHa cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:200 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Analysis of paraffin-embedded human kidney tissue using anti-Acetyl CoA Carboxylase 1 (ACC1) antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/200 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chrogen. Counter stained with hematoxylin and mounted with DPX.
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Staining Acetyl CoA Carboxylase 1 (ACC1) in MCF-7 cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:100 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ACSL5 Antibody
NBP1-59645
Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - IHC analysis of human skeletal muscle tissue. Antibody concentration of 4 - 8ug/mL.
Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate. Antibody at a concentration of 1 ug/mL.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
CD40 Ligand/TNFSF5
[HRP]
DCDL40
(39 Publications)
Species: Hu
ACSL1 Antibody
NBP1-89270
Western Blot: ACSL1 Antibody [NBP1-89270] - Analysis using Anti-ACSL1 antibody NBP1-89270 (A) shows similar pattern to independent antibody NBP1-89271 (B).
Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NBP1-89270] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Myeloperoxidase/MPO An ...
AF3667
Western blot shows lysates of HL‑60 human acute promyelocytic leukemia cell line, human neutrophil cells, and mouse spleen tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Myeloperoxidase/MPO at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of mouse spleen tissue, loaded at 0.2 mg/mL. A specific band was detected for Myeloperoxidase/MPO at approximately 67 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Myeloperoxidase/MPO was detected in immersion fixed mouse splenocytes using Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(5 Reviews)
(29 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
(1 Review)
(16 Publications)
Species: Hu
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
PHACS Antibody
(1D2)
H00084680-M02
PHACS Antibody (1D2)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for PHACS Antibody (H00084680-M02) (0)

There are no publications for PHACS Antibody (H00084680-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHACS Antibody (H00084680-M02) (0)

There are no reviews for PHACS Antibody (H00084680-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHACS Antibody (H00084680-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PHACS Products

Bioinformatics Tool for PHACS Antibody (H00084680-M02)

Discover related pathways, diseases and genes to PHACS Antibody (H00084680-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHACS Antibody (H00084680-M02)

Discover more about diseases related to PHACS Antibody (H00084680-M02).
 

Pathways for PHACS Antibody (H00084680-M02)

View related products by pathway.

Blogs on PHACS

There are no specific blogs for PHACS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHACS Antibody (1D2) and receive a gift card or discount.


Bioinformatics

Gene Symbol ACCS
Entrez
OMIM
Uniprot