PHACS Antibody (1D2)

Images

 
Western Blot: PHACS Antibody (1D2) [H00084680-M02] - Analysis of PHACS expression in transfected 293T cell line by PHACS monoclonal antibody (M02), clone 1D2.Lane 1: PHACS transfected lysate(57.34 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: PHACS Antibody (1D2) [H00084680-M02] - Analysis of monoclonal antibody to PHACS on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PHACS Antibody (1D2) Summary

Immunogen
PHACS (NP_115981, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIIN
Specificity
PHACS - 1-aminocyclopropane-1-carboxylate synthase
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACCS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHACS Antibody (1D2)

  • 1-aminocyclopropane-1-carboxylate synthase homolog(Arabidopsis)(non-functional)
  • 1-aminocyclopropane-1-carboxylate synthase-like protein 1
  • PHACSACSACC synthase-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCRP00
Species: Hu
Applications: ELISA
MAB1266
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
NB100-56561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
DKK300
Species: Hu
Applications: ELISA
NBP3-15744
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-59645
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
DCDL40
Species: Hu
Applications: ELISA
NBP1-89270
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00084680-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for PHACS Antibody (H00084680-M02) (0)

There are no publications for PHACS Antibody (H00084680-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHACS Antibody (H00084680-M02) (0)

There are no reviews for PHACS Antibody (H00084680-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHACS Antibody (H00084680-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHACS Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACCS
Entrez
OMIM
Uniprot