PGK1 Antibody

Images

 
Immunohistochemistry-Paraffin: PGK1 Antibody [NBP2-54721] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGK1 Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
Specificity
Specificity of human PGK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGK1 Recombinant Protein Antigen (NBP2-54721PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGK1 Antibody

  • Cell migration-inducing gene 10 protein
  • EC 2.7.2.3
  • MGC142128
  • MGC8947
  • MIG10
  • PGK1
  • PGKA
  • PGKAMGC117307
  • phosphoglycerate kinase 1
  • Primer recognition protein 2
  • PRP 2
  • PRP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NB600-533
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IP
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP1-31470
Species: Hu, Mu, Rt, Bv, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-48336
Species: Hu, Mu, Po, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for PGK1 Antibody (NBP2-54721) (0)

There are no publications for PGK1 Antibody (NBP2-54721).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGK1 Antibody (NBP2-54721) (0)

There are no reviews for PGK1 Antibody (NBP2-54721). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGK1 Antibody (NBP2-54721) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PGK1 Products

Bioinformatics Tool for PGK1 Antibody (NBP2-54721)

Discover related pathways, diseases and genes to PGK1 Antibody (NBP2-54721). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGK1 Antibody (NBP2-54721)

Discover more about diseases related to PGK1 Antibody (NBP2-54721).
 

Pathways for PGK1 Antibody (NBP2-54721)

View related products by pathway.

PTMs for PGK1 Antibody (NBP2-54721)

Learn more about PTMs related to PGK1 Antibody (NBP2-54721).
 

Research Areas for PGK1 Antibody (NBP2-54721)

Find related products by research area.

Blogs on PGK1

There are no specific blogs for PGK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGK1