Home » PGK1 » PGK1 Antibodies » PGK1 Antibody

PGK1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: PGK1 Antibody [NBP2-54721] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: PGK1 Antibody [NBP2-54721] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PGK1 Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
Specificity
Specificity of human PGK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGK1 Recombinant Protein Antigen (NBP2-54721PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGK1 Antibody

  • Cell migration-inducing gene 10 protein
  • EC 2.7.2.3
  • MGC142128
  • MGC8947
  • MIG10
  • PGK1
  • PGKA
  • PGKAMGC117307
  • phosphoglycerate kinase 1
  • Primer recognition protein 2
  • PRP 2
  • PRP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GAPDH Antibody
(1D4)
NB300-221
Western Blot: GAPDH Antibody (1D4) [NB300-221] - analysis of GAPDH in human nucleus pulposus cell culture (40ug/lane) using anti-GAPDH antibody. LI-COR Odyssey imaging system was used for detection. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - Analysis of of HeLa cells stained with GAPDH antibody, dilution 1:100 (Green). DAPI staining of nuclear DNA (Blue). The GAPDHantibody produces strong cytoplasmic staining of healthy cells.
Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
(17 Reviews)
(323 Publications)
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - HIF-1 alpha induction by CoCl2 on Caki-1 cell lysate. WB image submitted by a verified customer review.
Knockout Validated: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - HIF-1 alpha was detected in immersion fixed DFO treated Hela cells (left) but was not detected in HIF-1 knockout HeLa cells (right) using Mouse Anti-human HIF-1 alpha monoclonal antibody (Catalog # NB100-105) at 25 ug/mL for 3 hours at room temperature. Cells were stained using a NorthernLights (TM) 557-conjugated Donkey Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei.
Western Blot: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
(40 Reviews)
(868 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
HPRT Antibody
NBP1-33527
Western Blot: HPRT Antibody [NBP1-33527] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: HPRT Antibody [NBP1-33527] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-33527] - Paraffin-embedded rat colon. HPRT antibody diluted at 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Hexokinase 1
Antibody (ST47-05)
NBP2-67503
Western Blot: Hexokinase 1 Antibody (ST47-05) [NBP2-67503] - Analysis of Hexokinase 1 on different lysates using anti-Hexokinase 1 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: 293 Lane 3: MCF-7 Lane 4: HepG2
Immunocytochemistry/Immunofluorescence: Hexokinase 1 Antibody (ST47-05) [NBP2-67503] - Staining Hexokinase 1 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Hexokinase 1 Antibody (ST47-05) [NBP2-67503] - Analysis of paraffin-embedded mouse skin tissue using anti-Hexokinase 1 antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
VEGF [HRP]
DVE00
(26 Reviews)
(514 Publications)
Species: Hu
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - MCDK cells induced with C22H24N2O8 to control the expression of the gene of interest. Beta-actin blocking confirms the albumin assay showing that an equal amount of lysate was loaded in each lane.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Image shows a specific band for Beta-Actin in 0.2 mg/mL of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - Beta-Actin expression in Fibroblast Hs68 cell lysate using anti-beta-Actin antibody. Image from verified customer review.
(25 Reviews)
(438 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
Actin Gamma 1
Antibody
NB600-533
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Knockdown of DLK in differentiated Neuro-2a cells. Neuro-2a cells were infected with an empty lentiviral vector (pLKO.1) or with lentivirus expressing mouse DLK shRNAs (sh73 and sh69). After infection and selection with puromycin, cells were subjected to differentiation for 24 h before being processed for total RNA extraction and whole-cell extracts. Representative Western blots showing levels of DLK, phospho-JNK (p-JNK), total JNK, phospho-c-Jun (p-c-Jun) and actin in infected Neuro-2a cells. Image collected and cropped by CiteAb from the following publication (http://neuraldevelopment.biomedcentral.com/articles/10.1186/s13064-016-0068-8), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Actin Gamma 1 Antibody [NB600-533] - Detection of Actin Gamma 1 (Green) in Hela cells using NB600-533 at a 1:50 dilution. Nuclei (Blue) were counterstained using Hoechst 33258.
Immunohistochemistry: Actin Gamma 1 Antibody [NB600-533] - Sample: FFPE section of human testicular seminoma. Antibody: Affinity purified rabbit anti-Actin used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(6 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IP
beta
2-Microglobulin Antib
NB500-317
Western Blot: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Analysis using the FITC conjugate of NB500-317. Detection (non-reducing conditions) of whole cell lysate of various cell lines Lane 1: RAJI human Burkitt lymphoma cell line Lane 2: EL4 mouse lymphoblastic lymphoma cell line Lane 3: U937 human histiocytic lymphoma cell line.
Immunocytochemistry/Immunofluorescence: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Confocal microscopy of human beta2-microglobulin-transfected canine cells labeled A) with B2M-01 antibody Alexa Fluor (R) 647 conjugate and B) with Alexa Fluor (R) 647 conjugated Mouse IgG2a Isotype Control. Cells were fixed with 4% PFA and permeabilized with 0.1% PBS-Tween20 containing 2% BSA. Antibody concentration 2ug/ml.
Flow Cytometry: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Staining of beta-2-microglobulin in human peripheral blood with anti-beta-2-microglobulin (B2M-01) biotin.
(1 Review)
(2 Publications)
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
Triosephosphate
isomerase Antibody
NBP1-31470
Western Blot: Triosephosphate isomerase Antibody [NBP1-31470] - Immunodetection of glycolytic enzymes within bat and human cells. Immunodetection of Eno1, Tpi1, Pgam1 and beta2-Tub (load control) in Poly I:C transfected and Control PaKiT03 cells at 4, 8 and 20 hpt. Image collected and cropped by CiteAb from the following publication (http://www.proteomesci.com/content/13/1/25), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Triosephosphate isomerase Antibody [NBP1-31470] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Triosephosphate isomerase stained by Triosephosphate isomerase antibody [C2C3], C-term diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar= 10um.
Immunohistochemistry-Paraffin: Triosephosphate isomerase Antibody [NBP1-31470] - Paraffin-embedded SNU-16 xenograft, using antibody at 1:100 dilution.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt, Bv, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Cyclophilin A
Antibody [Unconjugate
AF3589
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, C2C12 mouse myoblast cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclophilin A at approximately 18 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclophilin A at approximately 25 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Cyclophilin A was detected in immersion fixed PANC-1 human pancreatic carcinoma cell line using Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Erythropoietin/EPO
[HRP]
MEP00B
(3 Reviews)
(77 Publications)
Species: Mu
RPLP0 Antibody
NBP1-82859
Immunocytochemistry/Immunofluorescence: RPLP0 Antibody [NBP1-82859] - Staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TATA binding
protein TBP Antibody ...
NBP2-59208
Western Blot: TATA binding protein TBP Antibody (C.15200002) [NBP2-59208] - Whole cell extracts (40 ug) from HeLa cells transfected with TBP siRNA (lane 2) and from an untransfected control (lane 1) were analysed by Western blot using the antibody against TBP diluted 1:500 in TBSTween containing 5% skimmed milk. The position of the protein of interest is indicated on the right; the marker (kDa) is shown on the left.
Chromatin Immunoprecipitation Sequencing: TATA binding protein TBP Antibody (C.15200002) [NBP2-59208] - IP'd DNA was analyzed by QPCR with optimized PCR primer pairs for the promoters of the active GAPDH and c-fos genes, used as positive control targets, and for a region 1 kb upstream of the GAPDH promoter and the coding region of the inactive MB gene, used as negative control targets (A). The IP'd DNA was analyzed with an Illumina Genome Analyzer. Library preparation, cluster generation and sequencing were performed according to the manufacturer's instructions. The 36 bp tags were aligned to the human genome using the ELAND algorithm. Figure shows the peak distribution in 50 kb regions surrounding the GAPDH, c-fos, ACTB and MCL1 genes (B, C, D and E, respectively). These results clearly show a localisation of TBP at the promoters of actively transcribed genes.
Chromatin Immunoprecipitation: TATA binding protein TBP Antibody (C.15200002) [NBP2-59208] - ChIP results obtained with the antibody against TBP. ChIP assays were performed using U2OS cells, the antibody were used per ChIP experiment. QPCR was performed with primers for the promoter of the c-fos and GAPDH genes, a region 0.5 and 1 kb upstream of the GAPDH promoter, respectively, and for exon 2 of the myoglobin gene as a negative control. Figure shows the recovery (the relative amount of immunoprecipitated DNA compared to input DNA) and the occupancy (ratio +/- control target). These results demonstrate the occupancy of both promoters by TBP.
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
HYPB Antibody
(CL9956)
NBP2-88941
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HYPB Antibody (CL9956) [NBP2-88941] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P

beta-Glucuronidase/GUS ...
AF6144
Western blot shows lysates of HT‑29 human colon adenocarcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Human beta ‑Glucuronidase/GUSB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6144) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for beta ‑Glucuronidase/GUSB at approximately 82 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of HT‑29 human colon adenocarcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for beta ‑Glucuronidase/GUSB at approximately 92 kDa (as indicated) using 10 µg/mL of Sheep Anti-Human beta ‑Glucuronidase/GUSB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6144) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western
EIF3B Antibody
NBP2-24571
Western Blot: EIF3B Antibody [NBP2-24571] - analysis of eIF3B in A431 cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) NIH 3T3 cell lysate using eIF3B antibody at 0.25 ug/ml, 0.25 ug/ml and 0.05 ug/ml respectively.
Immunohistochemistry-Paraffin: EIF3B Antibody [NBP2-24571] - Formalin-fixed, paraffin-embedded human brain tissue stained with eIF3B antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Simple Western: EIF3B Antibody [NBP2-24571] - Simple Western lane view shows a specific band for EIF3B in 0.5 mg/ml of A431 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
Lactate
Dehydrogenase A/LDHA
NBP1-48336
Western Blot: Lactate Dehydrogenase A/LDHA Antibody [NBP1-48336] - Increased lactate level detected in the hippocampus of streptozotocin-injected mice fed an HFD (HFD + STZ). Cropped images of LDHA and LDHB in the cortex. Image collected and cropped by Cite Ab from the following publication (Hyperpolarized [1-13C]lactate flux increased in the hippocampal region in diabetic mice. Mol Brain (2019) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Lactate Dehydrogenase A/LDHA Antibody [NBP1-48336] - Immunocytochemical analysis of Lactate Dehydrogenase A in HeLa cells
Immunohistochemistry: Lactate Dehydrogenase A/LDHA Antibody [NBP1-48336] - Staining of postnatal day 8(P8) Plp-EGFP transgenic mice brain section. Image from verified customer review.
(4 Reviews)
(18 Publications)
Species: Hu, Mu, Po, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
SDHA Antibody
(JM10-83)
NBP2-67130
Western Blot: SDHA Antibody (JM10-83) [NBP2-67130] - Analysis of SDHA on Jurkat cells lysates using anti-SDHA antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: SDHA Antibody (JM10-83) [NBP2-67130] - Staining SDHA in NIH-3T3 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: SDHA Antibody (JM10-83) [NBP2-67130] - Analysis of paraffin-embedded zebrafish tissue using anti-SDHA antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for PGK1 Antibody (NBP2-54721) (0)

There are no publications for PGK1 Antibody (NBP2-54721).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGK1 Antibody (NBP2-54721) (0)

There are no reviews for PGK1 Antibody (NBP2-54721). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGK1 Antibody (NBP2-54721) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PGK1 Products

Bioinformatics Tool for PGK1 Antibody (NBP2-54721)

Discover related pathways, diseases and genes to PGK1 Antibody (NBP2-54721). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGK1 Antibody (NBP2-54721)

Discover more about diseases related to PGK1 Antibody (NBP2-54721).
 

Pathways for PGK1 Antibody (NBP2-54721)

View related products by pathway.

PTMs for PGK1 Antibody (NBP2-54721)

Learn more about PTMs related to PGK1 Antibody (NBP2-54721).
 

Research Areas for PGK1 Antibody (NBP2-54721)

Find related products by research area.

Blogs on PGK1

There are no specific blogs for PGK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGK1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PGK1