PGCP Antibody

Images

 
Immunohistochemistry-Paraffin: PGCP Antibody [NBP1-87545] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGCP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPQ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGCP Protein (NBP1-87545PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGCP Antibody

  • aminopeptidase
  • CPQ
  • EC 3.4.17
  • EC 3.4.17.-
  • Hls2
  • Lal-1
  • PGCP
  • plasma glutamate carboxypeptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-30458
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for PGCP Antibody (NBP1-87545) (0)

There are no publications for PGCP Antibody (NBP1-87545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGCP Antibody (NBP1-87545) (0)

There are no reviews for PGCP Antibody (NBP1-87545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGCP Antibody (NBP1-87545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGCP Products

Bioinformatics Tool for PGCP Antibody (NBP1-87545)

Discover related pathways, diseases and genes to PGCP Antibody (NBP1-87545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGCP Antibody (NBP1-87545)

Discover more about diseases related to PGCP Antibody (NBP1-87545).
 

Pathways for PGCP Antibody (NBP1-87545)

View related products by pathway.

PTMs for PGCP Antibody (NBP1-87545)

Learn more about PTMs related to PGCP Antibody (NBP1-87545).

Blogs on PGCP

There are no specific blogs for PGCP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGCP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPQ
Entrez