PGCP Antibody - BSA Free

Immunohistochemistry-Paraffin: PGCP Antibody [NBP1-87545] - Staining of human thyroid gland shows high expression.

Immunohistochemistry-Paraffin: PGCP Antibody [NBP1-87545] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PGCP Antibody [NBP1-87545] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: PGCP Antibody [NBP1-87545] - Staining in human thyroid gland and cerebral cortex tissues using anti-CPQ antibody. Corresponding CPQ RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PGCP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPQ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PGCP Protein (NBP1-87545PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PGCP Antibody - BSA Free

• aminopeptidase
• CPQ
• EC 3.4.17
• EC 3.4.17.-
• Hls2
• Lal-1
• PGCP
• plasma glutamate carboxypeptidase

Background

Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPQ