Peripherin Antibody (3B3)

Images

 
Western Blot: Peripherin Antibody (3B3) [H00005630-M02] - PRPH monoclonal antibody (M02), clone 3B3. Analysis of PRPH expression in IMR-32.
Immunocytochemistry/ Immunofluorescence: Peripherin Antibody (3B3) [H00005630-M02] - Analysis of monoclonal antibody to PRPH on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Peripherin Antibody (3B3) [H00005630-M02] - Analysis of monoclonal antibody to PRPH on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Sandwich ELISA: Peripherin Antibody (3B3) [H00005630-M02] - Detection limit for recombinant GST tagged PRPH is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
3B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Peripherin Antibody (3B3) Summary

Immunogen
PRPH (NP_006253 374 a.a. - 470 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Marker
Un-myelinated Neurons Marker
Specificity
Reacts with peripherin.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRPH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate in WB and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Peripherin Antibody (3B3)

  • neurofilament 4 (57kD)
  • Neurofilament 4
  • peripherin
  • PRPH1NEF4

Background

This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58068
Species: Hu
Applications: ICC/IF, IHC-P
NB300-140
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NB300-133
Species: Hu, Mu, Rt, Po, Av, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Peripherin Antibody (H00005630-M02) (0)

There are no publications for Peripherin Antibody (H00005630-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peripherin Antibody (H00005630-M02) (0)

There are no reviews for Peripherin Antibody (H00005630-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Peripherin Antibody (H00005630-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Peripherin Products

Bioinformatics Tool for Peripherin Antibody (H00005630-M02)

Discover related pathways, diseases and genes to Peripherin Antibody (H00005630-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peripherin Antibody (H00005630-M02)

Discover more about diseases related to Peripherin Antibody (H00005630-M02).
 

Pathways for Peripherin Antibody (H00005630-M02)

View related products by pathway.

PTMs for Peripherin Antibody (H00005630-M02)

Learn more about PTMs related to Peripherin Antibody (H00005630-M02).
 

Research Areas for Peripherin Antibody (H00005630-M02)

Find related products by research area.

Blogs on Peripherin.

A Look at Peripherin: The Unknown Filament
The exact function of Peripherin, or Neurofilament 4, is unknown however it has been suggested to play a role in axon formation and determining and maintaining the shape of nerve cells. Peripherin is a 470 amino acid Class-III neuronal intermediate fi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peripherin Antibody (3B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPH
Entrez
Uniprot