Pericentrin Antibody

Immunocytochemistry/Immunofluorescence: Pericentrin Antibody [NBP2-58501] - Staining of human cell line U-251 MG shows localization to centrosome.

Product Discontinued

Pericentrin Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLLGLFGETLRAAVTLRSRIGERVGLCLDDAGAGLALSTAPALEETWSDVALPELDRTLSECAEMSSVAEISSHMRESFLMSPESVRECEQPI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCNT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Pericentrin Antibody

• Kendrin
• KIAA0402
• MOPD2
• PCN
• PCNT2pericentrin B
• PCNTB
• pericentrin 2 (kendrin)
• pericentrin
• pericentrin, kendrin (KIAA0402)10KENPCTN2
• pericentrin-2
• pericentrin-380
• pericentrin-B
• SCKL4kendrin

Background

Pericentrin is encoded by this gene binds to calmodulin and is expressed in the centrosome. It is an integral component of the pericentriolar material (PCM). The protein contains a series of coiled-coil domains and a highly conserved PCM targeting motif called the PACT domain near its C-terminus. The protein interacts with the microtubule nucleation component gamma-tubulin and is likely important to normal functioning of the centrosomes, cytoskeleton, and cell-cycle progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCNT