Pericentrin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Pericentrin Antibody [NBP2-58501] - Staining of human cell line U-251 MG shows localization to centrosome.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pericentrin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLLGLFGETLRAAVTLRSRIGERVGLCLDDAGAGLALSTAPALEETWSDVALPELDRTLSECAEMSSVAEISSHMRESFLMSPESVRECEQPI
Specificity
Specificity of human Pericentrin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCNT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pericentrin Recombinant Protein Antigen (NBP2-58501PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Pericentrin Antibody

  • Kendrin
  • KIAA0402
  • MOPD2
  • PCN
  • PCNT2pericentrin B
  • PCNTB
  • pericentrin 2 (kendrin)
  • pericentrin
  • pericentrin, kendrin (KIAA0402)10KENPCTN2
  • pericentrin-2
  • pericentrin-380
  • pericentrin-B
  • SCKL4kendrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1107
Species: Mu
Applications: WB, IHC
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB100-74351
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: GS, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58501
Species: Hu
Applications: ICC/IF

Publications for Pericentrin Antibody (NBP2-58501) (0)

There are no publications for Pericentrin Antibody (NBP2-58501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pericentrin Antibody (NBP2-58501) (0)

There are no reviews for Pericentrin Antibody (NBP2-58501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Pericentrin Antibody (NBP2-58501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Pericentrin Products

Bioinformatics Tool for Pericentrin Antibody (NBP2-58501)

Discover related pathways, diseases and genes to Pericentrin Antibody (NBP2-58501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pericentrin Antibody (NBP2-58501)

Discover more about diseases related to Pericentrin Antibody (NBP2-58501).
 

Pathways for Pericentrin Antibody (NBP2-58501)

View related products by pathway.

PTMs for Pericentrin Antibody (NBP2-58501)

Learn more about PTMs related to Pericentrin Antibody (NBP2-58501).
 

Research Areas for Pericentrin Antibody (NBP2-58501)

Find related products by research area.

Blogs on Pericentrin

There are no specific blogs for Pericentrin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pericentrin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCNT