PCM1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCM1 Antibody [NBP1-87195] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87195] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87195] - Staining of human testis shows moderate cytoplasmic positivity.
Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87195] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87195] - Staining of human small intestine shows weak to moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCM1 Protein (NBP1-87195PEP)
Publications
Read Publications using
NBP1-87195 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25335909).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCM1 Antibody

  • hPCM-1
  • pericentriolar material 1 protein
  • pericentriolar material 1
  • PTC4PCM-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2988
Species: Mu, Rt
Applications: WB
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
NBP1-87195
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PCM1 Antibody (NBP1-87195)(4)

Reviews for PCM1 Antibody (NBP1-87195) (0)

There are no reviews for PCM1 Antibody (NBP1-87195). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCM1 Antibody (NBP1-87195) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCM1 Products

Bioinformatics Tool for PCM1 Antibody (NBP1-87195)

Discover related pathways, diseases and genes to PCM1 Antibody (NBP1-87195). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCM1 Antibody (NBP1-87195)

Discover more about diseases related to PCM1 Antibody (NBP1-87195).
 

Pathways for PCM1 Antibody (NBP1-87195)

View related products by pathway.

PTMs for PCM1 Antibody (NBP1-87195)

Learn more about PTMs related to PCM1 Antibody (NBP1-87195).
 

Research Areas for PCM1 Antibody (NBP1-87195)

Find related products by research area.

Blogs on PCM1

There are no specific blogs for PCM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCM1