PDP2 Antibody - BSA Free

Western Blot: PDP2 Antibody [NBP1-82912] - Analysis of PDP2 in HEK293T, MCF7, OV90 and K562 whole cell lysates using anti-PDP2 antibody. Image from verified customer review.

Immunohistochemistry-Paraffin: PDP2 Antibody [NBP1-82912] - Staining of human stomach shows strong cytoplasmic positivity in Parietal cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Validated from a verified customer review
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PDP2 Protein (NBP1-82912PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PDP2 Antibody - BSA Free

• EC 3.1.3
• EC 3.1.3.43
• KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
• PDP 2
• PDPC 2
• PPM2C2
• protein phosphatase 2C, magnesium-dependent, catalytic subunit 2
• Pyruvate dehydrogenase phosphatase catalytic subunit 2
• pyruvate dehydrogenase phosphatase isoenzyme 2
• pyruvate dehydrogenase phosphatase, catalytic subunit 2
• pyruvate dehyrogenase phosphatase catalytic subunit 2

Background

PDP2 catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDP2 Antibody (NBP1-82912)(2)

Publications using NBP1-82912

• Lai, N, Fealy, C E Et al. Mitochondrial Utilization of Competing Fuels Is Altered in Insulin Resistant Skeletal Muscle of Non-obese Rats (Goto-Kakizaki). Front Physiol 2020-07-03 [PMID: 32612543] (WB, Mouse)
• Abdul-Muneer PM, Alikunju S, Schuetz H et al. Impairment of Thiamine Transport at the GUT-BBB-AXIS Contributes to Wernicke's Encephalopathy Molecular Neurobiology 2018-07-01 [PMID: 29128903] (Immunohistochemistry, Western Blot)

Review for PDP2 Antibody (NBP1-82912) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 05/22/2015

Summary

• Application: Western Blot
• Sample Tested: HEK293T, MCF7, OV90 and K562 whole cell lysates
• Species: Human
• Lot: R09750

Bioinformatics

• Gene Symbol: PDP2