PDP2 Antibody

Images

 
Western Blot: PDP2 Antibody [NBP1-82912] - Analysis in human cell line CACO-2.
Immunohistochemistry-Paraffin: PDP2 Antibody [NBP1-82912] - Staining of human stomach shows strong cytoplasmic positivity in Parietal cells.
Western Blot: PDP2 Antibody [NBP1-82912] - Analysis of PDP2 in HEK293T, MCF7, OV90 and K562 whole cell lysates using anti-PDP2 antibody. Image from verified customer review.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDP2 Protein (NBP1-82912PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-82912 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDP2 Antibody

  • EC 3.1.3
  • EC 3.1.3.43
  • KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
  • PDP 2
  • PDPC 2
  • PPM2C2
  • protein phosphatase 2C, magnesium-dependent, catalytic subunit 2
  • Pyruvate dehydrogenase phosphatase catalytic subunit 2
  • pyruvate dehydrogenase phosphatase isoenzyme 2
  • pyruvate dehydrogenase phosphatase, catalytic subunit 2
  • pyruvate dehyrogenase phosphatase catalytic subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NBP1-32581
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87307
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3159
Species: Mu
Applications: WB, IHC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-82912
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PDP2 Antibody (NBP1-82912) (0)

There are no publications for PDP2 Antibody (NBP1-82912).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PDP2 Antibody (NBP1-82912) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82912:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PDP2 NBP1-82912
Enlarge
reviewed by:
Anonymous
WB Human 05/22/2015
View

Summary

ApplicationWestern Blot
Sample TestedHEK293T, MCF7, OV90 and K562 whole cell lysates
SpeciesHuman
LotR09750

Blocking

Blocking Details4% BSA in TBST for 1h at room temperature

Primary Anitbody

Dilution Ratio1:2000 in TBST + 1%BSA, overnight, 4*C

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG-HRP
Secondary Manufacturer Cat#sc-2301
Secondary Concentration1:10,000

Details

Detection NotesECL

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDP2 Antibody (NBP1-82912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDP2 Products

Bioinformatics Tool for PDP2 Antibody (NBP1-82912)

Discover related pathways, diseases and genes to PDP2 Antibody (NBP1-82912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDP2 Antibody (NBP1-82912)

Discover more about diseases related to PDP2 Antibody (NBP1-82912).
 

Pathways for PDP2 Antibody (NBP1-82912)

View related products by pathway.

PTMs for PDP2 Antibody (NBP1-82912)

Learn more about PTMs related to PDP2 Antibody (NBP1-82912).
 

Research Areas for PDP2 Antibody (NBP1-82912)

Find related products by research area.

Blogs on PDP2

There are no specific blogs for PDP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/22/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol PDP2