PDP2 Antibody


Western Blot: PDP2 Antibody [NBP1-82912] - Analysis in human cell line CACO-2.
Immunohistochemistry-Paraffin: PDP2 Antibody [NBP1-82912] - Staining of human stomach shows strong cytoplasmic positivity in Parietal cells.
Western Blot: PDP2 Antibody [NBP1-82912] - Analysis of PDP2 in HEK293T, MCF7, OV90 and K562 whole cell lysates using anti-PDP2 antibody. Image from verified customer review.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PDP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGE
Specificity of human PDP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDP2 Protein (NBP1-82912PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-82912 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PDP2 Antibody

  • EC 3.1.3
  • EC
  • KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
  • PDP 2
  • PDPC 2
  • PPM2C2
  • protein phosphatase 2C, magnesium-dependent, catalytic subunit 2
  • Pyruvate dehydrogenase phosphatase catalytic subunit 2
  • pyruvate dehydrogenase phosphatase isoenzyme 2
  • pyruvate dehydrogenase phosphatase, catalytic subunit 2
  • pyruvate dehyrogenase phosphatase catalytic subunit 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Sq
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PDP2 Antibody (NBP1-82912) (0)

There are no publications for PDP2 Antibody (NBP1-82912).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PDP2 Antibody (NBP1-82912) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-82912:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot PDP2 NBP1-82912
reviewed by:
WB Human 05/22/2015


ApplicationWestern Blot
Sample TestedHEK293T, MCF7, OV90 and K562 whole cell lysates


Blocking Details4% BSA in TBST for 1h at room temperature

Primary Anitbody

Dilution Ratio1:2000 in TBST + 1%BSA, overnight, 4*C

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG-HRP
Secondary Manufacturer Cat#sc-2301
Secondary Concentration1:10,000


Detection NotesECL

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDP2 Antibody (NBP1-82912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PDP2 Products

Bioinformatics Tool for PDP2 Antibody (NBP1-82912)

Discover related pathways, diseases and genes to PDP2 Antibody (NBP1-82912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDP2 Antibody (NBP1-82912)

Discover more about diseases related to PDP2 Antibody (NBP1-82912).

Pathways for PDP2 Antibody (NBP1-82912)

View related products by pathway.

PTMs for PDP2 Antibody (NBP1-82912)

Learn more about PTMs related to PDP2 Antibody (NBP1-82912).

Research Areas for PDP2 Antibody (NBP1-82912)

Find related products by research area.

Blogs on PDP2

There are no specific blogs for PDP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol PDP2