PDK2 Antibody (5F8)

Images

 
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in 293.
Immunohistochemistry-Paraffin: PDK2 Antibody (5F8) [H00005164-M02] - Analysis of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 2 ug/ml.
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8 Analysis of PDK2 expression in HeLa.
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in A-431.
ELISA: PDK2 Antibody (5F8) [H00005164-M02] - Detection limit for recombinant GST tagged PDK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDK2 Antibody (5F8) Summary

Immunogen
PDK2 (AAH05811 187 a.a. - 276 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Specificity
PDK2 (5F8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDK2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
WB usage on cell lysate and recombinant protein reported in scientific literature (PMID: 22123926).
Positive Control
HeLa Lysate (NB800-PC1)
PDK2 Lysate (NBP2-64737)
Reviewed Applications
Read 1 Review rated 3
using
H00005164-M02 in the following applications:

Publications
Read Publication using H00005164-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDK2 Antibody (5F8)

  • EC 2.7.11
  • EC 2.7.11.2
  • lipoamide, kinase isozyme 2, mitochondrial
  • Pyruvate dehydrogenase kinase isoform 2
  • pyruvate dehydrogenase kinase, isoenzyme 2
  • pyruvate dehydrogenase kinase, isozyme 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NBP2-67755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87308
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC, IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32581
Species: Hu, Mu, Sq
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDK2 Antibody (H00005164-M02)(1)


Review for PDK2 Antibody (H00005164-M02) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00005164-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Human 08/22/2015
View

Summary

ApplicationWestern Blot
Sample TestedHuman cancer cell whole cell lysate
SpeciesHuman

Blocking

Blocking DetailsBlocking with 5% non-fat milk for 30 min

Primary Anitbody

Dilution Ratio1:1000, overnight

Secondary Antibody

Secondary DescriptionSheep anti-mouse IgG, HRP
Secondary Manufacturer Cat#GE Healthcare, NA931V
Secondary Concentration1:2000

Details

Detection NotesRegular Western blot Protocol

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDK2 Antibody (H00005164-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PDK2 Antibody (H00005164-M02)

Discover related pathways, diseases and genes to PDK2 Antibody (H00005164-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK2 Antibody (H00005164-M02)

Discover more about diseases related to PDK2 Antibody (H00005164-M02).
 

Pathways for PDK2 Antibody (H00005164-M02)

View related products by pathway.

PTMs for PDK2 Antibody (H00005164-M02)

Learn more about PTMs related to PDK2 Antibody (H00005164-M02).
 

Research Areas for PDK2 Antibody (H00005164-M02)

Find related products by research area.

Blogs on PDK2

There are no specific blogs for PDK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

 
Anonymous
08/22/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol PDK2
Entrez
OMIM
Uniprot