Home » PDK2 » PDK2 Antibodies » PDK2 Antibody (5F8)

PDK2 Antibody (5F8)

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in A-431.
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in A-431.
Immunohistochemistry-Paraffin: PDK2 Antibody (5F8) [H00005164-M02] - Analysis of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 2 ug/ml.
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8 Analysis of PDK2 expression in HeLa.
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in 293.
ELISA: PDK2 Antibody (5F8) [H00005164-M02] - Detection limit for recombinant GST tagged PDK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
5F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PDK2 Antibody (5F8) Summary

Immunogen
PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Specificity
PDK2 (5F8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDK2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 2 ug/ml
Application Notes
WB usage on cell lysate and recombinant protein reported in scientific literature (PMID: 22123926).
Control
HeLa Whole Cell Lysate
PDK2 Knockout HeLa Cell Lysate
Reviewed Applications
Read 1 Review rated 3
using
H00005164-M02 in the following applications:
Publications
Read Publication using H00005164-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDK2 Antibody (5F8)

  • EC 2.7.11
  • EC 2.7.11.2
  • lipoamide, kinase isozyme 2, mitochondrial
  • Pyruvate dehydrogenase kinase isoform 2
  • pyruvate dehydrogenase kinase, isoenzyme 2
  • pyruvate dehydrogenase kinase, isozyme 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PDK4 Antibody
NBP1-07047
Western Blot: PDK4 Antibody [NBP1-07047] - Western Blot on human heart protein lysate.
Western Blot: PDK4 Antibody [NBP1-07047] - Mouse liver. NuPAGE 4-12%. This image was submitted via customer review.
Western Blot: PDK4 Antibody [NBP1-07047] - The protein expression levels in QF muscle. Representative Western blot images. n = 14-15 animals/group. * = vs. LFsed (P 0.1). Black bars = sedentary, grey bars = running. Image collected and cropped by CiteAb from the following publication (http://nutritionandmetabolism.biomedcentral.com/articles/10.1186/1743-7075-9-53), licensed under a CC-BY licence.
(2 Reviews)
(10 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF
Pyruvate
Dehydrogenase Kinase ...
NB100-2383
Western Blot: PDK-1 Antibody [NB100-2383] - Analysis of HeLa lysates using NB100-2383. Image courtesy of Gregg Semenza - publication number 21620138 (PMID).
Immunocytochemistry/Immunofluorescence: PDK-1 Antibody [NB100-2383] - Antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Western Blot: PDK-1 Antibody [NB100-2383] - Detection of PDK-1 in human heart lysate using NB 100-2383 at 2 ug/ml.
(2 Reviews)
(5 Publications)
Species: Hu
Applications: WB, ICC/IF
PDK-1 Antibody
(SD204-9)
NBP2-67755
Western Blot: PDK-1 Antibody (SD204-9) [NBP2-67755] - Analysis of PDPK1 on different lysates using anti-PDPK1 antibody at 1/1,000 dilution. Positive control: Lane 1: 293T Lane 2: PC-12 Lane 3: HL-60
Immunocytochemistry/Immunofluorescence: PDK-1 Antibody (SD204-9) [NBP2-67755] - Staining PDPK1 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PDK-1 Antibody (SD204-9) [NBP2-67755] - Analysis of paraffin-embedded mouse kidney tissue using anti-PDPK1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Pyruvate
Dehydrogenase Phospha ...
NBP1-87309
Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87309] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87309] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87309] - Staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: WB, IHC, IHC-P
Phosducin Antibody
NBP2-94660
Western Blot: Phosducin Antibody [NBP2-94660] - Analysis of extracts of various cell lines, using Phosducin at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.
Immunohistochemistry-Paraffin: Phosducin Antibody [NBP2-94660] - Paraffin-embedded rat retina using Phosducin.
Immunohistochemistry-Paraffin: Phosducin Antibody [NBP2-94660] - Paraffin-embedded mouse retina using Phosducin.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PNKD Antibody
NBP1-88347
Western Blot: PNKD Antibody [NBP1-88347] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PNKD antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: PNKD Antibody [NBP1-88347] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: PNKD Antibody [NBP1-88347] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PDK3 Antibody
NBP1-32581
Western Blot: PDK3 Antibody [NBP1-32581] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PDK3 antibody [N1C2] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PDK3 Antibody [NBP1-32581] - Methanol-fixed HepG2, using PDK3(NBP1-32581) antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PDK3 Antibody [NBP1-32581] - Ca922 xenograft, using PDK3 antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
(1 Review)
(3 Publications)
Species: Hu, Mu, Sq
Applications: WB, ICC/IF, IHC, IHC-P
PPAR alpha/NR1C1
Antibody (3B6/PPAR)
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Hek293 cells with PPAR alpha/NR1C1 [3B6/PPAR] Antibody NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP

Butyrylcholinesterase/ ...
AF9024
Western blot shows lysates of mouse heart tissue and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Polyclonal Antibody (Catalog # AF9024) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Butyrylcholinesterase/BCHE at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Butyrylcholinesterase/BCHE was detected in perfusion fixed frozen sections of mouse brain using Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF9024) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to glial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu, Rt
Applications: WB, IHC
Elastase Antibody
(CELA3B/1257)
NBP2-53246
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Rat Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Human Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257)
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
MASA Antibody
NBP2-13961
Western Blot: MASA Antibody [NBP2-13961] - Analysis in control (vector only transfected HEK293T lysate) and ENOPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: MASA Antibody [NBP2-13961] - Staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: MASA Antibody [NBP2-13961] - Staining in human cerebral cortex and pancreas tissues using anti-ENOPH1 antibody. Corresponding ENOPH1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Human Breast Cancer, using PI3K gamma antibody. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Whole cell extract (30ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
ZACN Antibody
NBP1-80104
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
PPFIBP1 Antibody
NBP1-83192
Western Blot: PPFIBP1 Antibody [NBP1-83192] - Analysis in human cell lines Caco-2 and HEK293 using Anti-PPFIBP1 antibody. Corresponding PPFIBP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/Immunofluorescence: PPFIBP1 Antibody [NBP1-83192] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: PPFIBP1 Antibody [NBP1-83192] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells and adnexal cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDK2 Antibody (H00005164-M02)(1)


Review for PDK2 Antibody (H00005164-M02) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00005164-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
  3
reviewed by:
Anonymous
 WB Human 08/22/2015
View

Summary

ApplicationWestern Blot
Sample TestedHuman cancer cell whole cell lysate
SpeciesHuman

Blocking

Blocking DetailsBlocking with 5% non-fat milk for 30 min

Primary Anitbody

Dilution Ratio1:1000, overnight

Secondary Antibody

Secondary DescriptionSheep anti-mouse IgG, HRP
Secondary Manufacturer Cat#GE Healthcare, NA931V
Secondary Concentration1:2000

Details

Detection NotesRegular Western blot Protocol

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDK2 Antibody (H00005164-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

HeLa Whole Cell Lysate
PDK2 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PDK2 Products

Bioinformatics Tool for PDK2 Antibody (H00005164-M02)

Discover related pathways, diseases and genes to PDK2 Antibody (H00005164-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK2 Antibody (H00005164-M02)

Discover more about diseases related to PDK2 Antibody (H00005164-M02).
 

Pathways for PDK2 Antibody (H00005164-M02)

View related products by pathway.

PTMs for PDK2 Antibody (H00005164-M02)

Learn more about PTMs related to PDK2 Antibody (H00005164-M02).
 

Research Areas for PDK2 Antibody (H00005164-M02)

Find related products by research area.

Blogs on PDK2

There are no specific blogs for PDK2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
 
 Anonymous
08/22/2015
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol PDK2
Entrez
OMIM
Uniprot