PDK2 Antibody (5F8) - Azide and BSA Free

Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in A-431.

Immunohistochemistry-Paraffin: PDK2 Antibody (5F8) [H00005164-M02] - Analysis of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 2 ug/ml.

Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8 Analysis of PDK2 expression in HeLa.

Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in 293.

ELISA: PDK2 Antibody (5F8) [H00005164-M02] - Detection limit for recombinant GST tagged PDK2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 5F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PDK2 Antibody (5F8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
• Specificity: PDK2 (5F8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PDK2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 2 ug/ml
  • Western Blot 1:100-1:2000
• Application Notes: WB usage on cell lysate and recombinant protein reported in scientific literature (PMID: 22123926).
• Control:

  HeLa Whole Cell Lysate

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDK2 Antibody (5F8) - Azide and BSA Free

• EC 2.7.11
• EC 2.7.11.2
• lipoamide, kinase isozyme 2, mitochondrial
• PDH kinase 2
• PDHK2
• PDK2
• PDKII
• Pyruvate dehydrogenase kinase isoform 2
• pyruvate dehydrogenase kinase, isoenzyme 2
• pyruvate dehydrogenase kinase, isozyme 2

Background

PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDK2 Antibody (H00005164-M02)(1)

Publication using H00005164-M02

• Contractor T, Harris CR. p53 negatively regulates transcription of the pyruvate dehydrogenase kinase Pdk2. Cancer Research. 2011-11-28 [PMID: 22123926]

Review for PDK2 Antibody (H00005164-M02) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 08/22/2015

Summary

• Application: Western Blot
• Sample Tested: Human cancer cell whole cell lysate
• Species: Human

Bioinformatics

• Gene Symbol: PDK2
• Entrez:
  • 5164(Human)
• OMIM:
  • 602525(Human)
• Uniprot:
  • AAH05811(Human)