Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, IHC, IHC-P |
Clone | 5F8 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM |
Specificity | PDK2 (5F8) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | PDK2 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||||
Application Notes | WB usage on cell lysate and recombinant protein reported in scientific literature (PMID: 22123926). |
||||
Control |
|
||||
Reviewed Applications |
|
||||
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00005164-M02 | Applications | Species |
---|---|---|
Contractor T, Harris CR. p53 negatively regulates transcription of the pyruvate dehydrogenase kinase Pdk2. Cancer Research. 2011 Nov 28. [PMID: 22123926] |
Images | Ratings | Applications | Species | Date | Details | ||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
reviewed by:
Anonymous |
WB | Human | 08/22/2015 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
|
Secondary Antibodies |
Isotype Controls |
Diseases for PDK2 Antibody (H00005164-M02)Discover more about diseases related to PDK2 Antibody (H00005164-M02).
| Pathways for PDK2 Antibody (H00005164-M02)View related products by pathway.
|
PTMs for PDK2 Antibody (H00005164-M02)Learn more about PTMs related to PDK2 Antibody (H00005164-M02).
| Research Areas for PDK2 Antibody (H00005164-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.