Home » PDK2 » PDK2 Antibodies » PDK2 Antibody (5F8)

PDK2 Antibody (5F8)

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in 293.
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in 293.
Immunohistochemistry-Paraffin: PDK2 Antibody (5F8) [H00005164-M02] - Analysis of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 2 ug/ml.
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8 Analysis of PDK2 expression in HeLa.
Western Blot: PDK2 Antibody (5F8) [H00005164-M02] - PDK2 monoclonal antibody (M02), clone 5F8. Analysis of PDK2 expression in A-431.
ELISA: PDK2 Antibody (5F8) [H00005164-M02] - Detection limit for recombinant GST tagged PDK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PDK2 Antibody (5F8) Summary

Immunogen
PDK2 (AAH05811 187 a.a. - 276 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Specificity
PDK2 (5F8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDK2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
WB usage on cell lysate and recombinant protein reported in scientific literature (PMID: 22123926).
Positive Control
HeLa Lysate (NB800-PC1)
PDK2 Lysate (NBP2-64737)
Reviewed Applications
Read 1 Review rated 3
using
H00005164-M02 in the following applications:
Publications
Read Publication using H00005164-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDK2 Antibody (5F8)

  • EC 2.7.11
  • EC 2.7.11.2
  • lipoamide, kinase isozyme 2, mitochondrial
  • Pyruvate dehydrogenase kinase isoform 2
  • pyruvate dehydrogenase kinase, isoenzyme 2
  • pyruvate dehydrogenase kinase, isozyme 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PDK4 Antibody
NBP1-07047
Western Blot: PDK4 Antibody [NBP1-07047] - Mouse liver. NuPAGE 4-12%. This image was submitted via customer review.
Western Blot: PDK4 Antibody [NBP1-07047] - Western Blot on human heart protein lysate.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF
PDK-1 Antibody
NB100-2383
Western Blot: PDK-1 Antibody [NB100-2383] - Analysis of HeLa lysates using NB100-2383. Image courtesy of Gregg Semenza - publication number 21620138 (PMID).
Immunocytochemistry/Immunofluorescence: PDK-1 Antibody [NB100-2383] - Antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Western Blot: PDK-1 Antibody [NB100-2383] - Detection of PDK-1 in human heart lysate using NB 100-2383 at 2 ug/ml.
(2 Reviews)
(3 Publications)
Species: Hu
Applications: WB, ICC/IF
PDPK1 Antibody
(SD204-9)
NBP2-67755
Western Blot: PDPK1 Antibody (SD204-9) [NBP2-67755] - Analysis of PDPK1 on different lysates using anti-PDPK1 antibody at 1/1,000 dilution. Positive control: Lane 1: 293T Lane 2: PC-12 Lane 3: HL-60
Immunocytochemistry/Immunofluorescence: PDPK1 Antibody (SD204-9) [NBP2-67755] - Staining PDPK1 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PDPK1 Antibody (SD204-9) [NBP2-67755] - Analysis of paraffin-embedded mouse kidney tissue using anti-PDPK1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Pyruvate
Dehydrogenase Phospha ...
NBP1-87308
Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Analysis in human cell lines SK-MEL-30 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Phosducin Antibody
NBP2-56992
Immunohistochemistry-Paraffin: Phosducin Antibody [NBP2-56992] - Immunohistochemical staining of human testis shows strong acrosome positivity in subsets of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Phosducin Antibody [NBP2-56992] - Staining of retina shows strong cytoplasmic and nuclear positivity in photoreceptor layer.
Species: Hu
Applications: IHC, IHC-P
PNKD Antibody
NBP1-88347
Western Blot: PNKD Antibody [NBP1-88347] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7
Immunocytochemistry/Immunofluorescence: PNKD Antibody [NBP1-88347] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: PNKD Antibody [NBP1-88347] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PDK3 Antibody
NBP1-32581
Western Blot: PDK3 Antibody [NBP1-32581] - Whole cell extract (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with PDK3 antibody [N1C2] diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PDK3 Antibody [NBP1-32581] - Methanol-fixed HepG2, using PDK3(NBP1-32581) antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PDK3 Antibody [NBP1-32581] - Paraffin-embedded Ca922 xenograft, using antibody at 1:100 dilution.
(1 Review)
(2 Publications)
Species: Hu, Mu, Sq
Applications: WB, ICC/IF, IHC, IHC-P
PPAR alpha/NR1C1
Antibody (3B6/PPAR)
NB300-537
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - 293T cell lysate. Image from verified customer review.
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP

Butyrylcholinesterase/ ...
NBP2-03523
Western Blot: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] Analysis of extracts (35ug) from 9 different cell lines by using anti-Butyrylcholinesterase monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Flow Cytometry: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Butyrylcholinesterase antibody, and then analyzed by flow cytometry.
Western Blot: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Butyrylcholinesterase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Butyrylcholinesterase.
Species: Hu, Ca
Applications: WB, Flow
Elastase Antibody
(CELA3B/1257)
NBP2-47645
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-47645] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-47645] - Formalin-fixed, paraffin-embedded Human Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257)
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-47645] - Formalin-fixed, paraffin-embedded Rat Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
MASA Antibody
NBP2-13961
Western Blot: MASA Antibody [NBP2-13961] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: MASA Antibody [NBP2-13961] - Staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: MASA Antibody [NBP2-13961] - Staining in human cerebral cortex and pancreas tissues using anti-ENOPH1 antibody. Corresponding ENOPH1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining in human kidney and pancreas tissues using anti-DBT antibody. Corresponding DBT RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
Immunohistochemistry: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Used at 5 ug/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate staining of proximal convoluted tubules of the kidney. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain.
(5 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Paraffin-embedded Human Breast Cancer
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Whole cell extract (30ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
ZACN Antibody
NBP1-80104
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
PPFIBP1 Antibody
NBP1-83192
Western Blot: PPFIBP1 Antibody [NBP1-83192] - Analysis in human cell lines Caco-2 and HEK293 using Anti-PPFIBP1 antibody. Corresponding PPFIBP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/Immunofluorescence: PPFIBP1 Antibody [NBP1-83192] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: PPFIBP1 Antibody [NBP1-83192] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells and adnexal cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDK2 Antibody (H00005164-M02)(1)


Review for PDK2 Antibody (H00005164-M02) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00005164-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
 WB Human 08/22/2015
View

Summary

ApplicationWestern Blot
Sample TestedHuman cancer cell whole cell lysate
SpeciesHuman

Blocking

Blocking DetailsBlocking with 5% non-fat milk for 30 min

Primary Anitbody

Dilution Ratio1:1000, overnight

Secondary Antibody

Secondary DescriptionSheep anti-mouse IgG, HRP
Secondary Manufacturer Cat#GE Healthcare, NA931V
Secondary Concentration1:2000

Details

Detection NotesRegular Western blot Protocol

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDK2 Antibody (H00005164-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

HeLa Whole Cell Lysate
PDK2 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PDK2 Antibody (H00005164-M02)

Discover related pathways, diseases and genes to PDK2 Antibody (H00005164-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK2 Antibody (H00005164-M02)

Discover more about diseases related to PDK2 Antibody (H00005164-M02).
 

Pathways for PDK2 Antibody (H00005164-M02)

View related products by pathway.

PTMs for PDK2 Antibody (H00005164-M02)

Learn more about PTMs related to PDK2 Antibody (H00005164-M02).
 

Research Areas for PDK2 Antibody (H00005164-M02)

Find related products by research area.

Blogs on PDK2

There are no specific blogs for PDK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
 
 Anonymous
08/22/2015
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol PDK2
Entrez
OMIM
Uniprot