PDP2 Antibody

Images

 
Western Blot: PDP2 Antibody [NBP1-57641] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PDP2 (pyruvate dehyrogenase phosphatase catalytic subunit 2) The peptide sequence was selected from the middle region of PDP2. Peptide sequence LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDP2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDP2 Antibody

  • EC 3.1.3
  • EC 3.1.3.43
  • KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
  • PDP 2
  • PDPC 2
  • PPM2C2
  • protein phosphatase 2C, magnesium-dependent, catalytic subunit 2
  • Pyruvate dehydrogenase phosphatase catalytic subunit 2
  • pyruvate dehydrogenase phosphatase isoenzyme 2
  • pyruvate dehydrogenase phosphatase, catalytic subunit 2
  • pyruvate dehyrogenase phosphatase catalytic subunit 2

Background

PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87308
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP2-56992
Species: Hu
Applications: IHC, IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NBP1-32581
Species: Hu, Mu, Sq
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75611
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-67755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-66995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western

Publications for PDP2 Antibody (NBP1-57641) (0)

There are no publications for PDP2 Antibody (NBP1-57641).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDP2 Antibody (NBP1-57641) (0)

There are no reviews for PDP2 Antibody (NBP1-57641). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDP2 Antibody (NBP1-57641) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PDP2 Products

Bioinformatics Tool for PDP2 Antibody (NBP1-57641)

Discover related pathways, diseases and genes to PDP2 Antibody (NBP1-57641). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDP2 Antibody (NBP1-57641)

Discover more about diseases related to PDP2 Antibody (NBP1-57641).
 

Pathways for PDP2 Antibody (NBP1-57641)

View related products by pathway.

PTMs for PDP2 Antibody (NBP1-57641)

Learn more about PTMs related to PDP2 Antibody (NBP1-57641).
 

Research Areas for PDP2 Antibody (NBP1-57641)

Find related products by research area.

Blogs on PDP2

There are no specific blogs for PDP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDP2
Uniprot