![Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Analysis in human placenta and skeletal muscle tissues using NBP1-92250 antibody. Corresponding PDIA5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PDIR-Antibody-Immunohistochemistry-Paraffin-NBP1-92250-img0012.jpg "Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Analysis in human placenta and skeletal muscle tissues using NBP1-92250 antibody. Corresponding PDIA5 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit PDIR Antibody - BSA Free (NBP1-92250) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKFAEKYDSDRTELGFTNYIRALREGDHERLGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDIA5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PDIR Antibody (NBP1-92250)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDIA5 |
![Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human liver, placenta, skeletal muscle and testis using Anti-PDIA5 antibody NBP1-92250 (A) shows similar protein distribution across tissues to independent antibody NBP1-92252 (B).](http://images.novusbio.com/fullsize/PDIR-Antibody-Immunohistochemistry-Paraffin-NBP1-92250-img0011.jpg "Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human liver, placenta, skeletal muscle and testis using Anti-PDIA5 antibody NBP1-92250 (A) shows similar protein distribution across tissues to independent antibody NBP1-92252 (B).")
![Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human testis shows moderate to strong granular cytoplasmic positivity Leydig cells and in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PDIR-Antibody-Immunohistochemistry-Paraffin-NBP1-92250-img0014.jpg "Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human testis shows moderate to strong granular cytoplasmic positivity Leydig cells and in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/PDIR-Antibody-Immunohistochemistry-Paraffin-NBP1-92250-img0005.jpg "Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human placenta shows high expression.")
![Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/PDIR-Antibody-Immunohistochemistry-Paraffin-NBP1-92250-img0013.jpg "Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/PDIR-Antibody-Immunohistochemistry-Paraffin-NBP1-92250-img0015.jpg "Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92250] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry Myocilin Antibody (297817) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3446_human-myocilin-mab-clone-297817-immunohistochemistry-222023115227.jpg)
![Western Blot Myocilin Antibody (297817) [Unconjugated]](https://images.novusbio.com/images/mab3446_human-myocilin-mab-clone-297817-8120255531646.jpg)
![Western Blot Myocilin Antibody (297817) [Unconjugated]](https://images.novusbio.com/images/mab3446_human-myocilin-mab-clone-297817-812025557214.jpg)
![Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1543_human-bmp-3b-gdf-10-affinity-purified-polyclonal-ab-immunocytochemistry-133202414504.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")