SLC10A5 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-85965] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-85965] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-85965] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC10A5 Antibody [NBP1-85965] - Staining of human liver shows strong membranous positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC10A5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDRNILMLILPLILLNKCAFGCKIEL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC10A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC10A5 Protein (NBP1-85965PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC10A5 Antibody

  • Na(+)/bile acid cotransporter 5
  • P5
  • sodium/bile acid cotransporter 5
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 5
  • Solute carrier family 10 member 5

Background

SLC10A5 is a gene that codes for a multi-pass membrane protein that is 438 amino acids in length and has a weight of approximately 49 kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC10A5 Antibody (NBP1-85965) (0)

There are no publications for SLC10A5 Antibody (NBP1-85965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC10A5 Antibody (NBP1-85965) (0)

There are no reviews for SLC10A5 Antibody (NBP1-85965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC10A5 Antibody (NBP1-85965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC10A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC10A5