PDGF R beta Antibody

Images

 
Western Blot: PDGF R beta Antibody [NBP1-88134] - Analysis in human cell line U-87 MG.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDGF R beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDGFRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250-1:500
Control Peptide
PDGF R beta Protein (NBP1-88134PEP)
Publications
Read Publication using
NBP1-88134 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23441134).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDGF R beta Antibody

  • beta-type platelet-derived growth factor receptor
  • CD140 antigen-like family member B
  • CD140b antigen
  • CD140b
  • EC 2.7.10
  • EC 2.7.10.1
  • JTK12
  • PDGF R beta
  • PDGFR
  • PDGFR1
  • PDGFRB
  • PDGF-R-beta
  • platelet-derived growth factor receptor, beta polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1062
Species: Mu
Applications: WB, IHC, Neut
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NB110-60980
Species: Hu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
221-AA
Species: Hu
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PDGF R beta Antibody (NBP1-88134)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PDGF R beta Antibody (NBP1-88134) (0)

There are no reviews for PDGF R beta Antibody (NBP1-88134). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDGF R beta Antibody (NBP1-88134) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDGF R beta Products

Bioinformatics Tool for PDGF R beta Antibody (NBP1-88134)

Discover related pathways, diseases and genes to PDGF R beta Antibody (NBP1-88134). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDGF R beta Antibody (NBP1-88134)

Discover more about diseases related to PDGF R beta Antibody (NBP1-88134).
 

Pathways for PDGF R beta Antibody (NBP1-88134)

View related products by pathway.

PTMs for PDGF R beta Antibody (NBP1-88134)

Learn more about PTMs related to PDGF R beta Antibody (NBP1-88134).
 

Research Areas for PDGF R beta Antibody (NBP1-88134)

Find related products by research area.

Blogs on PDGF R beta

There are no specific blogs for PDGF R beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDGF R beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDGFRB
Entrez