PD-L2/B7-DC/PDCD1LG2 Antibody


Immunocytochemistry/ Immunofluorescence: PD-L2/B7-DC/PDCD1LG2 Antibody [NBP1-88964] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PD-L2/B7-DC/PDCD1LG2 Antibody [NBP1-88964] - Staining of human stomach shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PD-L2/B7-DC/PDCD1LG2 Antibody [NBP1-88964] - Staining of human tonsil shows moderate membranous positivity.
Immunohistochemistry-Paraffin: PD-L2/B7-DC/PDCD1LG2 Antibody [NBP1-88964] - Staining of human lung shows moderate cytoplasmic positivity.
Immunohistochemistry-Paraffin: PD-L2/B7-DC/PDCD1LG2 Antibody [NBP1-88964] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PD-L2/B7-DC/PDCD1LG2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
Specificity of human PD-L2/B7-DC/PDCD1LG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PD-L2/B7-DC/PDCD1LG2 Protein (NBP1-88964PEP)
Read Publication using NBP1-88964.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24748806)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PD-L2/B7-DC/PDCD1LG2 Antibody

  • B7-DC
  • bA574F11.2
  • Btdc
  • Butyrophilin B7-DC
  • Butyrophilin-like Protein
  • CD273 antigen
  • CD273
  • CD273PD-1 ligand 2
  • MGC142240
  • PD-1-ligand 2
  • PDCD1L2MGC142238
  • PDCD1LG2
  • PDL2
  • PD-L2
  • PDL2B7DC
  • PD-L2PDCD1 ligand 2
  • programmed cell death 1 ligand 2
  • Programmed death ligand 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, AgAct
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: B/N, Flow, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964)(1)

Reviews for PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964) (0)

There are no reviews for PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PD-L2/B7-DC/PDCD1LG2 Products

Bioinformatics Tool for PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964)

Discover related pathways, diseases and genes to PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964)

Discover more about diseases related to PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964).

Pathways for PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964)

View related products by pathway.

PTMs for PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964)

Learn more about PTMs related to PD-L2/B7-DC/PDCD1LG2 Antibody (NBP1-88964).

Blogs on PD-L2/B7-DC/PDCD1LG2

There are no specific blogs for PD-L2/B7-DC/PDCD1LG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PD-L2/B7-DC/PDCD1LG2 Antibody and receive a gift card or discount.


Gene Symbol PDCD1LG2