PD-1 Antibody

Images

 
Western Blot: PD-1 Antibody [NBP1-88104] - Analysis in control (vector only transfected HEK293T lysate) and pDCD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PD-1 Antibody [NBP1-88104] - Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PD-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDCD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PD-1 Recombinant Protein Antigen (NBP1-88104PEP)
Publications
Read Publication using NBP1-88104.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PD-1 Antibody

  • CD279 antigen
  • CD279
  • hPD-1
  • PD-1
  • PD1hPD-l
  • PDCD1
  • programmed cell death 1
  • programmed cell death protein 1
  • Protein PD-1
  • SLEB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-76769
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2365
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for PD-1 Antibody (NBP1-88104)(1)

Reviews for PD-1 Antibody (NBP1-88104) (0)

There are no reviews for PD-1 Antibody (NBP1-88104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PD-1 Antibody (NBP1-88104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PD-1 Products

Bioinformatics Tool for PD-1 Antibody (NBP1-88104)

Discover related pathways, diseases and genes to PD-1 Antibody (NBP1-88104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PD-1 Antibody (NBP1-88104)

Discover more about diseases related to PD-1 Antibody (NBP1-88104).
 

Pathways for PD-1 Antibody (NBP1-88104)

View related products by pathway.

PTMs for PD-1 Antibody (NBP1-88104)

Learn more about PTMs related to PD-1 Antibody (NBP1-88104).
 

Research Areas for PD-1 Antibody (NBP1-88104)

Find related products by research area.

Blogs on PD-1.

Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PD-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD1
Entrez