PCID2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PCID2 Antibody - BSA Free (NBP2-57674) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS |
| Predicted Species |
Mouse (99%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PCID2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PCID2 Antibody - BSA Free
Background
PCID2, also known as PCI domain-containing protein 2, belongs to the CSN12 family, is a protein with 4 isoforms ranging from a 376 amino acid that is 43 kDa to a 453 amino acid that is 52 kDa, regulates the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation necessary for B-cell survival. Disease research has shown correlation of this protein with malaria. This protein has been linked to the negative regulation of apoptotic process, regulation of mRNA stability, positive regulation of B cell differentiations, positive regulation of transcription, DNA-dependent and spleen development pathways where it interacts with KPNB1, SMAD2, BRF2, NEK6 and SHFM1 proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: BA
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for PCID2 Antibody (NBP2-57674) (0)
There are no publications for PCID2 Antibody (NBP2-57674).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCID2 Antibody (NBP2-57674) (0)
There are no reviews for PCID2 Antibody (NBP2-57674).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PCID2 Antibody (NBP2-57674) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PCID2 Products
Research Areas for PCID2 Antibody (NBP2-57674)
Find related products by research area.
|
Blogs on PCID2