Home » PCID2 » PCID2 Antibodies » PCID2 Antibody

PCID2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PCID2 Antibody [NBP2-57674] - Staining of human cell line HeLa shows localization to nucleus & nucleoli.
Immunocytochemistry/ Immunofluorescence: PCID2 Antibody [NBP2-57674] - Staining of human cell line HeLa shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PCID2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS
Specificity
Specificity of human PCID2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCID2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCID2 Recombinant Protein Antigen (NBP2-57674PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PCID2 Antibody

  • CSN12-like protein
  • DKFZp686C20226
  • F10
  • FLJ11305
  • FLJ99362
  • MGC16774
  • PCI domain containing 2
  • PCI domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in B16F1 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human stomach cancer tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(37 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
IL-6 [HRP]
D6050
(25 Reviews)
(463 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Human Factor V
ELISA Kit (Colorimetr
NBP2-82505
ELISA: Human Factor V ELISA Kit (Colorimetric) [NBP2-82505] - Standard Curve Reference
Species: Hu
TTF2 Antibody (1E8)
H00008458-M06
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of monoclonal antibody to TTF2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in PC-12 (Cat # L012V1).
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma.
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(19 Reviews)
(333 Publications)
Species: Hu
Prolactin Antibody
[Unconjugated]
AF1445
Western blot shows lysates of mouse pituitary tissue and rat pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse/Rat Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1445) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Mouse Prolactin (Catalog # 1445-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Rec­ombinant Mouse Prolactin (10 ng/mL) is neutralized (green line) by increasing concen­trations of Goat Anti-Mouse/Rat Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1445). The ND50 is typically 0.25-1.0 µg/mL.
(5 Publications)
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry: CD8 Antibody (53-6.7) [NBP1-49045] - Histopathological analysis of spinal cord in EAE mice. Representative spinal cord sections from wild-type (WT), Asic1-/-, and Asic2-/- mice at 45 days after immunization. Sections of the spinal cord anterior horn were stained with hematoxylin and eosin (E&H) to assess inflammation and immunostained for MCHII, CD4+, CD8+ infiltrating cells. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/ejn.14302), licensed under a CC-BY licence.
Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Factor XII Antibody
NBP1-94203
Western Blot: Factor XII/F12 Antibody [NBP1-94203] - WB analysis of F12 in 1. NIH 3T3 cell lysate and 2. Cos7 cell lysate.
Immunocytochemistry/Immunofluorescence: Factor XII Antibody [NBP1-94203] - F12 antibody was tested in NIH/3T3 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: Factor XII Antibody [NBP1-94203] - IHC analysis of F12 in human renal cancer using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
TRP2 Antibody
NBP1-86892
Western Blot: TRP2 Antibody [NBP1-86892] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Factor VIII
Antibody
NB100-91761
Western Blot: Factor VIII Antibody [NB100-91761] - Detection of Factor VIII protein in extracts from human umbilical vein endothelial cells (HUVECs).
Immunocytochemistry/Immunofluorescence: Factor VIII Antibody [NB100-91761] - Factor VIII antibody was tested 1:50 in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40X.
Immunohistochemistry-Paraffin: Factor VIII Antibody [NB100-91761] - Staining of Factor VIII in a formalin fixed and paraffin embedded tissue section of mouse bladder. The primary antibody was used at 1:100 dilution and the detection was performed using DAB with hematoxylin counterstaining.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
VEGF [HRP]
DVE00
(26 Reviews)
(514 Publications)
Species: Hu
Human Factor IX
ELISA Kit (Colorimetr ...
NBP2-60518
ELISA: Human Factor IX ELISA Kit (Colorimetric) [NBP2-60518] - Standard curve.
ELISA: Human Factor IX ELISA Kit (Colorimetric) [NBP2-60518] - Standard curve.
Species: Hu
Coagulation Factor
VII Antibody [Unconju ...
AF2338
Western blot shows human plasma and lysate of human liver tissue. PVDF membrane was probed with 2 µg/mL of Goat Anti-Human Coagulation Factor VII Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2338) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Coagulation Factor VII at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Coagulation Factor VII was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Goat Anti-Human Coagulation Factor VII Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2338) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Publications)
Species: Hu
Applications: WB, IP, ICC
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
(1 Review)
(16 Publications)
Species: Hu
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO

Publications for PCID2 Antibody (NBP2-57674) (0)

There are no publications for PCID2 Antibody (NBP2-57674).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCID2 Antibody (NBP2-57674) (0)

There are no reviews for PCID2 Antibody (NBP2-57674). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCID2 Antibody (NBP2-57674) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PCID2 Products

Bioinformatics Tool for PCID2 Antibody (NBP2-57674)

Discover related pathways, diseases and genes to PCID2 Antibody (NBP2-57674). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCID2 Antibody (NBP2-57674)

Discover more about diseases related to PCID2 Antibody (NBP2-57674).
 

Pathways for PCID2 Antibody (NBP2-57674)

View related products by pathway.

Research Areas for PCID2 Antibody (NBP2-57674)

Find related products by research area.

Blogs on PCID2

There are no specific blogs for PCID2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCID2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PCID2