PCID2 Antibody - BSA Free

Western Blot: PCID2 Antibody [NBP1-91487] - Titration: 1.0 ug/ml Positive Control: Rat Heart.

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PCID2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human RGD1307041. Peptide sequence MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCID2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PCID2 Antibody - BSA Free

• CSN12-like protein
• DKFZp686C20226
• F10
• FLJ11305
• FLJ99362
• MGC16774
• PCI domain containing 2
• PCI domain-containing protein 2

Background

PCID2, also known as PCI domain-containing protein 2, belongs to the CSN12 family, is a protein with 4 isoforms ranging from a 376 amino acid that is 43 kDa to a 453 amino acid that is 52 kDa, regulates the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation necessary for B-cell survival. Disease research has shown correlation of this protein with malaria. This protein has been linked to the negative regulation of apoptotic process, regulation of mRNA stability, positive regulation of B cell differentiations, positive regulation of transcription, DNA-dependent and spleen development pathways where it interacts with KPNB1, SMAD2, BRF2, NEK6 and SHFM1 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCID2
• Uniprot:
  • NP_001162615(Rat)