| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Pax2 Antibody - BSA Free (NBP2-57700) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Pax2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TKVQQPFHPTPDGAGTGVTAPGHTIVPSTAS |
| Predicted Species | Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PAX2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, retrieval method: HIER pH6 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-57700 | Applications | Species |
|---|---|---|
| Rore H, Owen N, Pina-Aguilar Re Et Al. Testicular somatic cell-like cells derived from embryonic stem cells induce differentiation of epiblasts into germ cells Communications biology 2021-06-28 [PMID: 34183774] (ICC/IF) | ICC/IF |
Secondary Antibodies |
Isotype Controls |
Research Areas for Pax2 Antibody (NBP2-57700)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PAX2 |