Pax2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Pax2 Antibody [NBP2-57700] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pax2 Antibody [NBP2-57700] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: Pax2 Antibody [NBP2-57700] -Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pax2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TKVQQPFHPTPDGAGTGVTAPGHTIVPSTAS
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAX2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, retrieval method: HIER pH6
Control Peptide
Pax2 Recombinant Protein Antigen (NBP2-57700PEP)
Publications
Read Publication using NBP2-57700.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34183774)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Pax2 Antibody

  • paired box 2
  • paired box gene 2
  • paired box homeotic gene 2
  • paired box protein Pax-2
  • Pax2

Background

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pax2 Antibody (NBP2-57700)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for Pax2 Antibody (NBP2-57700) (0)

There are no reviews for Pax2 Antibody (NBP2-57700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Pax2 Antibody (NBP2-57700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pax2 Products

Research Areas for Pax2 Antibody (NBP2-57700)

Find related products by research area.

Blogs on Pax2

There are no specific blogs for Pax2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX2