PAUF/ZG16B Antibody

Images

 
Western Blot: PAUF/ZG16B Antibody [NBP1-81699] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699] - Staining of human testis.
Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699] - Staining of human salivary gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699] - Staining in human salivary gland and colon tissues using anti-ZG16B antibody. Corresponding ZG16B RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699] - Staining of human colon, liver, salivary gland and testis using Anti-ZG16B antibody NBP1-81699 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAUF/ZG16B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQA
Specificity
Specificity of human PAUF/ZG16B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZG16B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAUF/ZG16B Antibody

  • DKFZp762P2216
  • EC 3.1.2
  • EC 3.4.19.12
  • EECP
  • HRPE773
  • hTrabid
  • JCLN2
  • LOC124220
  • PAUF
  • PRO1567
  • TRABIDubiquitin thioesterase ZRANB1
  • TRAF-binding protein domain
  • ZG16B
  • Zinc finger Ran-binding domain-containing protein 1
  • zinc finger, RAN-binding domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009973-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF2905
Species: Hu
Applications: WB, ELISA, ICC
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF4779
Species: Hu
Applications: WB, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-56722
Species: Hu, Mu, Rt, Ca
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP1-62178
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-01833
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-80513
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81699
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PAUF/ZG16B Antibody (NBP1-81699) (0)

There are no publications for PAUF/ZG16B Antibody (NBP1-81699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAUF/ZG16B Antibody (NBP1-81699) (0)

There are no reviews for PAUF/ZG16B Antibody (NBP1-81699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAUF/ZG16B Antibody (NBP1-81699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PAUF/ZG16B Products

Bioinformatics Tool for PAUF/ZG16B Antibody (NBP1-81699)

Discover related pathways, diseases and genes to PAUF/ZG16B Antibody (NBP1-81699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAUF/ZG16B Antibody (NBP1-81699)

Discover more about diseases related to PAUF/ZG16B Antibody (NBP1-81699).

Blogs on PAUF/ZG16B

There are no specific blogs for PAUF/ZG16B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAUF/ZG16B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZG16B
Novus 100% Guarantee