Home » CCS/SOD4 » CCS/SOD4 Antibodies » CCS/SOD4 Antibody (1E2)

CCS/SOD4 Antibody (1E2)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2. Lane 1: CCS transfected lysate (Predicted MW: 29 KDa). Lane 2: Non-transfected lysate.
Western Blot: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2. Lane 1: CCS transfected lysate (Predicted MW: 29 KDa). Lane ...read more
Immunohistochemistry-Paraffin: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Analysis of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1.5 ug/ml
Immunoprecipitation: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Analysis of CCS transfected lysate using anti-CCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCS monoclonal antibody.
ELISA: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Detection limit for recombinant GST tagged CCS is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP
Clone
1E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CCS/SOD4 Antibody (1E2) Summary

Immunogen
CCS (NP_005116, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Specificity
Reacts with copper chaperone for superoxide dismutase.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.
Publications
Read Publication using H00009973-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCS/SOD4 Antibody (1E2)

  • copper chaperone for superoxide dismutase
  • MGC138260
  • Superoxide dismutase copper chaperone

Background

Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
(3 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
ATOX1 Antibody
NBP1-06611
Western Blot: ATOX1 Antibody [NBP1-06611] - HeLa whole cell extract.
Immunocytochemistry/Immunofluorescence: ATOX1 Antibody [NBP1-06611] - ATOX1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(3 Publications)
Species: Hu
Applications: WB, ICC/IF
Calcitonin R
Antibody (462802) [Un ...
MAB4614
Calcitonin R knockout MCF-7 human breast cancer cell line was stained with Mouse Anti-Human Calcitonin R Monoclonal Antibody (Catalog # MAB4614, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram) followed by anti-Mouse IgG PE-conjugated secondary antibody (Catalog # F0102B). No staining in the Calcitonin R knockout MCF-7 cell line was observed. View our protocol for Staining Membrane-associated Proteins.
MCF‑7 human breast cancer cell line was stained with Mouse Anti-Human Calcitonin R Monoclonal Antibody (Catalog # MAB4614, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
(5 Publications)
Species: Hu
Applications: Flow, CyTOF-ready, KO
SLC31A1/CTR1
Antibody
NB100-402
Immunocytochemistry/Immunofluorescence: SLC31A1/CTR1 Antibody [NB100-402] - CTR1 antibody was tested in NIH-3T3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: SLC31A1/CTR1 Antibody [NB100-402] - Panel 1: human CTR1 staining of breast cancer tissue. Panel 2: human CTR1-antigen competition in breast cancer tissue.
Immunohistochemistry: SLC31A1/CTR1 Antibody [NB100-402] - Left panel: Antibody staining of hCTR1 overexpressing cell line. Right panel: Antibody plus peptide competition staining.
(20 Publications)
Species: Hu, Mu, Rt, Po, Ca, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Human
Ceruloplasmin ELISA K ...
NBP2-60616
ELISA: Human Ceruloplasmin ELISA Kit (Colorimetric) [NBP2-60616]
Species: Hu
Nucleostemin
Antibody [Unconjugate
AF1638
Nucleostemin was detected in immersion fixed U2OS human osteosarcoma cell line using 10 µg/mL Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Nucleostemin at approximately 83 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of PC‑3 human prostate cancer cell line and SW480 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Nucleostemin at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
COX17 Antibody
NBP2-99469
Western Blot: COX17 Antibody [NBP2-99469] - Anti-COX17 rabbit polyclonal antibody at 1:500 dilution. Lane A: HepG2 Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 7 kDa
Immunohistochemistry-Paraffin: COX17 Antibody [NBP2-99469] - Immunochemical staining of human COX17 in human testis with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: COX17 Antibody [NBP2-99469] - Immunochemical staining of human COX17 in human liver with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: WB, IHC, IHC-P, IP
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
C-Reactive
Protein/CRP [HRP]
DCRP00
(3 Reviews)
(83 Publications)
Species: Hu
Complement
Component C2b Antibod ...
MAB1936
Complement Component C2b Antibody (269716)
(3 Reviews)
(1 Publication)
Species: Hu
Applications: WB, IP
NDUFB6 Antibody
NBP1-92172
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Ataxin 1 Antibody
(2F5)
NBP1-51689
Western Blot: Ataxin 1 Antibody (2F5) [NBP1-51689] - Analysis using ATXN1 mab against HEK293 (1) and ATXN1 higGFC transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunofluorescence analysis of NTERA-2 cells using ATXN1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues (left) and lung cancer tissues (right) using ATXN1 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ATP7A Antibody
(S60-4)
NBP2-59376
Western Blot: ATP7A Antibody (S60-4) [NBP2-59376] - Analysis of Mouse Lung showing detection of >150 kDa Copper Transporting ATPase 1 protein using clone S60-4. 10 ug of sample was loaded and primary antibody was used at 1:1000. Predicted/Observed Size: ~160 kDa. Other band(s): 250 kDa.
Immunocytochemistry/Immunofluorescence: ATP7A Antibody (S60-4) [NBP2-59376] - Tissue: NIH 3T3 (Mouse Fibroblast cell line). Species: Mouse. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Endoplasmic Reticulum, Cytoplasm, Golgi Apparatus, Trans-Golgi Network Membrane, Cell Membrane. Magnification: 60X.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
PAUF/ZG16B Antibody
NBP1-81699
Western Blot: PAUF/ZG16B Antibody [NBP1-81699] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PAUF/ZG16B Antibody [NBP1-81699] - Staining of human liver.
Species: Hu
Applications: WB, IHC, IHC-P
Serpin A5/Protein
C Inhibitor Antibody ...
NBP2-01833
Western Blot: Serpin A5/Protein C Inhibitor Antibody (2D10) [NBP2-01833] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Protein C inhibitor (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Protein C inhibitor.
Immunocytochemistry/Immunofluorescence: Serpin A5/Protein C Inhibitor Antibody (OTI2D10) [NBP2-01833] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Protein C inhibitor.
Immunohistochemistry-Paraffin: Serpin A5/Protein C Inhibitor Antibody (2D10) [NBP2-01833] - Staining of paraffin-embedded Human tonsil using anti-Protein C inhibitor mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MITF Antibody
(21D1418)
NB100-56561
Western Blot: MITF Antibody (21D1418) [NB100-56561] - Analysis of A375 lysate using MITF antibody at 4 ug/ml.
Immunocytochemistry/Immunofluorescence: MITF Antibody (21D1418) [NB100-56561] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MITF Antibody (21D1418) NB100-56561 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: MITF Antibody (21D1418) [NB100-56561] - Analysis of a FFPE tissue section of human skin using 1:200 dilution of MITF (21D1418) antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. General cytoplasmic staining appears enriched in melanocytes below the epidermis. Some nuclear reactivity is observed as well.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ATF1 Antibody
NBP2-38747
Western Blot: ATF1 Antibody [NBP2-38747] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATF1 antibody. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: ATF1 Antibody [NBP2-38747] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining in human thyroid gland and pancreas tissues using anti-ATF1 antibody. Corresponding ATF1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
CCS/SOD4 Antibody
(1E2)
H00009973-M03
CCS/SOD4 Antibody (1E2)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for CCS/SOD4 Antibody (H00009973-M03)(1)


Reviews for CCS/SOD4 Antibody (H00009973-M03) (0)

There are no reviews for CCS/SOD4 Antibody (H00009973-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCS/SOD4 Antibody (H00009973-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CCS/SOD4 Products

Bioinformatics Tool for CCS/SOD4 Antibody (H00009973-M03)

Discover related pathways, diseases and genes to CCS/SOD4 Antibody (H00009973-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCS/SOD4 Antibody (H00009973-M03)

Discover more about diseases related to CCS/SOD4 Antibody (H00009973-M03).
 

Pathways for CCS/SOD4 Antibody (H00009973-M03)

View related products by pathway.

PTMs for CCS/SOD4 Antibody (H00009973-M03)

Learn more about PTMs related to CCS/SOD4 Antibody (H00009973-M03).

Blogs on CCS/SOD4

There are no specific blogs for CCS/SOD4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCS/SOD4 Antibody (1E2) and receive a gift card or discount.


Bioinformatics

Gene Symbol CCS
Entrez
Uniprot