Home » CCS/SOD4 » CCS/SOD4 Antibodies » CCS/SOD4 Antibody (1E2)

CCS/SOD4 Antibody (1E2)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2. Lane 1: CCS transfected lysate (Predicted MW: 29 KDa). Lane 2: Non-transfected lysate.
Western Blot: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2. Lane 1: CCS transfected lysate (Predicted MW: 29 KDa). Lane ...read more
Immunohistochemistry-Paraffin: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Analysis of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1.5 ug/ml
Immunoprecipitation: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Analysis of CCS transfected lysate using anti-CCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCS monoclonal antibody.
ELISA: CCS/SOD4 Antibody (1E2) [H00009973-M03] - Detection limit for recombinant GST tagged CCS is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP
Clone
1E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CCS/SOD4 Antibody (1E2) Summary

Immunogen
CCS (NP_005116, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Specificity
Reacts with copper chaperone for superoxide dismutase.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.
Publications
Read Publication using H00009973-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCS/SOD4 Antibody (1E2)

  • copper chaperone for superoxide dismutase
  • MGC138260
  • Superoxide dismutase copper chaperone

Background

Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(12 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ATOX1 Antibody
NBP1-06611
Immunocytochemistry/Immunofluorescence: ATOX1 Antibody [NBP1-06611] - ATOX1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Western Blot: ATOX1 Antibody [NBP1-06611] - HeLa whole cell extract.
(3 Publications)
Species: Hu
Applications: ICC/IF, WB
Calcitonin R
Antibody (462802) [Un ...
MAB4614
Calcitonin R knockout MCF-7 human breast cancer cell line was stained with Mouse Anti-Human Calcitonin R Monoclonal Antibody (Catalog # MAB4614, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram) followed by anti-Mouse IgG PE-conjugated secondary antibody (Catalog # F0102B). No staining in the Calcitonin R knockout MCF-7 cell line was observed. View our protocol for Staining Membrane-associated Proteins.
MCF‑7 human breast cancer cell line was stained with Mouse Anti-Human Calcitonin R Monoclonal Antibody (Catalog # MAB4614, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, KO
SLC31A1/CTR1
Antibody
NB100-402
Immunohistochemistry: SLC31A1/CTR1 Antibody [NB100-402] - Left panel: Antibody staining of hCTR1 overexpressing cell line. Right panel: Antibody plus peptide competition staining.
Immunohistochemistry: SLC31A1/CTR1 Antibody [NB100-402] - Panel 1: human CTR1 staining of breast cancer tissue. Panel 2: human CTR1-antigen competition in breast cancer tissue.
Immunocytochemistry/Immunofluorescence: SLC31A1/CTR1 Antibody [NB100-402] - CTR1 antibody was tested in NIH-3T3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(28 Publications)
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunohistochemistry of paraffin-embedded rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunohistochemistry of paraffin-embedded human liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunofluorescence analysis of rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Nucleostemin
Antibody [Unconjugate
AF1638
Nucleostemin was detected in immersion fixed U2OS human osteosarcoma cell line using 10 µg/mL Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Nucleostemin at approximately 83 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of PC‑3 human prostate cancer cell line and SW480 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Nucleostemin at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - miRNA-768-3p specifically targets K-ras. Effect of miRNA inhibitors that were reduced by co-culture on the level of pan-RAS, phospho-B-Raf and CD44 and pan-Akt by western blotting. Also shown is the effect of different miRNA inhibitors on the level of K-ras in H520 cells by western blot. Cropped blots are shown and were run under the same experimental conditions. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep02392), licensed under a CC-BY licence.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
COX17 Antibody
NBP2-99469
Immunohistochemistry-Paraffin: COX17 Antibody [NBP2-99469] - Immunochemical staining of human COX17 in human liver with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: COX17 Antibody [NBP2-99469] - Immunochemical staining of human COX17 in human testis with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunoprecipitation: COX17 Antibody [NBP2-99469] - COX17 was immunoprecipitated using: Lane A: 0.5 mg mouse kidney tissue Lysate 4 ul anti-COX17 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads. Protein A/G. Primary antibody: Anti-COX17 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 88 kDa. Observed band size: 130 kDa
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Rat tissue extract (50ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [GT1761] ) diluted at 1:1000.
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - A. 30 ug zebrafish heart lysate/extract 10 % SDS-PAGE Citrate synthetase antibody [GT1761] dilution: 1:1000
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
C-Reactive
Protein/CRP [HRP]
DCRP00
(4 Reviews)
(126 Publications)
Species: Hu
Applications: ELISA
Complement
Component C2b Antibod ...
MAB1936
Complement Component C2b Antibody (269716)
(4 Reviews)
(1 Publication)
Species: Hu
Applications: IP, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Ataxin 1 Antibody
(2F5)
NBP1-51689
Western Blot: Ataxin 1 Antibody (2F5) [NBP1-51689] - Analysis using ATXN1 mab against HEK293 (1) and ATXN1 higGFC transfected HEK293 (2) cell lysate.
Flow Cytometry: Ataxin 1 Antibody (2F5) [NBP1-51689] - Flow cytometric analysis of Jurket cells using ATXN1 mouse mAb (green) and negative control (purple).
Immunohistochemistry-Paraffin: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues (left) and lung cancer tissues (right) using ATXN1 mouse mAb with DAB staining.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ATP7A Antibody
(S60-4)
NBP2-59376
Western Blot: ATP7A Antibody (S60-4) [NBP2-59376] - Analysis of Mouse Lung showing detection of >150 kDa Copper Transporting ATPase 1 protein using clone S60-4. 10 ug of sample was loaded and primary antibody was used at 1:1000. Predicted/Observed Size: ~160 kDa. Other band(s): 250 kDa.
Western Blot: ATP7A Antibody (S60-4) [NBP2-59376] - Western Blot analysis of Rat Liver showing detection of ~180 kDa ATP7A protein using Mouse Anti-ATP7A Monoclonal Antibody, Clone S60-4 (NBP2-59376). Lane 1: MW Ladder. Lane 2: Rat Liver . Load: 10 ug. Block: 5% Skim Milk powder in TBST. Primary Antibody: Mouse ATP7A Monoclonal Antibody (NBP2-59376) at 1:500 for 2 hours at RT with shaking. Secondary Antibody: Goat anti-mouse IgG:HRP at 1:4000 for 1 hour at RT with shaking. Color Development: Chemiluminescent for HRP (Moss) for 5 min in RT. Predicted/Observed Size: ~180 kDa.
Immunocytochemistry/Immunofluorescence: ATP7A Antibody (S60-4) [NBP2-59376] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody, Clone S60-4 (NBP2-59376). Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody (NBP2-59376) at 1:100 for overnight at 4C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) Copper Transporting ATPase 1 Antibody (D) Composite.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
PAUF/ZG16B
Antibody (817310)
MAB7777
Western blot shows lysates of human placenta tissue and human prostate tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PAUF/ZG16B Monoclonal Antibody (Catalog # MAB7777) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PAUF/ZG16B at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PAUF/ZG16B was detected in immersion fixed paraffin-embedded sections of human pancreas cancer tissue using Mouse Anti-Human PAUF/ZG16B Monoclonal Antibody (Catalog # MAB7777) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membranes of cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: IHC, WB
Serpin A5/Protein
C Inhibitor Antibody ...
MAB1266
HepG2 human hepatocellular carcinoma cell line was stained with Mouse Anti-Human Serpin A5 Monoclonal Antibody (Catalog # MAB1266, filled histogram) or isotype control antibody (MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (FC005). Staining was performed using our Staining Intracellular Molecules protocol.
(2 Publications)
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
MITF Antibody
(21D1418) - BSA Free
NB100-56561
Immunohistochemistry-Paraffin: MITF Antibody (21D1418) [NB100-56561] - Analysis of a FFPE tissue section of human skin using 1:200 dilution of MITF (21D1418) antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. General cytoplasmic staining appears enriched in melanocytes below the epidermis. Some nuclear reactivity is observed as well.
Immunocytochemistry/Immunofluorescence: MITF Antibody (21D1418) [NB100-56561] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MITF Antibody (21D1418) NB100-56561 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Cells were imaged using a 100X objective and digitally deconvolved.
Western Blot: MITF Antibody (21D1418) [NB100-56561] - Analysis of HeLa lysate (35ug per lane, RIPA buffer) using MiTF antibody (NB100-56561) at 0.1ug/ml. Band detected at ~60kDa. (Expected MW of 58.2kDa according to NP_937802.1).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ATF1 Antibody
NBP2-38747
Immunocytochemistry/Immunofluorescence: ATF1 Antibody [NBP2-38747] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining of human thyroid gland shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
CCS/SOD4 Antibody
(1E2)
H00009973-M03
CCS/SOD4 Antibody (1E2)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for CCS/SOD4 Antibody (H00009973-M03)(1)


Reviews for CCS/SOD4 Antibody (H00009973-M03) (0)

There are no reviews for CCS/SOD4 Antibody (H00009973-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCS/SOD4 Antibody (H00009973-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCS/SOD4 Products

Bioinformatics Tool for CCS/SOD4 Antibody (H00009973-M03)

Discover related pathways, diseases and genes to CCS/SOD4 Antibody (H00009973-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCS/SOD4 Antibody (H00009973-M03)

Discover more about diseases related to CCS/SOD4 Antibody (H00009973-M03).
 

Pathways for CCS/SOD4 Antibody (H00009973-M03)

View related products by pathway.

PTMs for CCS/SOD4 Antibody (H00009973-M03)

Learn more about PTMs related to CCS/SOD4 Antibody (H00009973-M03).

Blogs on CCS/SOD4

There are no specific blogs for CCS/SOD4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCS/SOD4 Antibody (1E2) and receive a gift card or discount.


Bioinformatics

Gene Symbol CCS
Entrez
Uniprot