PARP2 Antibody

Images

 
Western Blot: PARP2 Antibody [NBP2-47337] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line U-2 OS
Immunocytochemistry/ Immunofluorescence: PARP2 Antibody [NBP2-47337] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
Immunohistochemistry-Paraffin: PARP2 Antibody [NBP2-47337] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PARP2 Antibody [NBP2-47337] - Staining of human pancreas shows no positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PARP2 Antibody [NBP2-47337] - Staining in human testis and pancreas tissues.. Corresponding PARP2 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARP2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKDRTEDKQDESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWM
Specificity
Specificity of human PARP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
PARP2 Lysate (NBP2-64776)
Control Peptide
PARP2 Protein (NBP2-47337PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARP2 Antibody

  • ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2
  • ADPRT-2
  • ADPRT2pADPRT-2
  • ADPRTL2EC 2.4.2.30
  • ADPRTL3
  • hPARP-2
  • NAD(+) ADP-ribosyltransferase 2
  • PARP-2
  • poly (ADP-ribose) polymerase 2
  • poly (ADP-ribose) polymerase family, member 2
  • poly (ADP-ribosyl) transferase-like 2
  • poly [ADP-ribose] polymerase 2
  • poly(ADP-ribose) synthetase
  • Poly[ADP-ribose] synthase 2
  • poly[ADP-ribose] synthetase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-46320
Species: Hu
Applications: WB, IHC
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31415
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
796-IC
Species: Mu

Publications for PARP2 Antibody (NBP2-47337) (0)

There are no publications for PARP2 Antibody (NBP2-47337).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP2 Antibody (NBP2-47337) (0)

There are no reviews for PARP2 Antibody (NBP2-47337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PARP2 Antibody (NBP2-47337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PARP2 Antibody (NBP2-47337)

Discover related pathways, diseases and genes to PARP2 Antibody (NBP2-47337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP2 Antibody (NBP2-47337)

Discover more about diseases related to PARP2 Antibody (NBP2-47337).
 

Pathways for PARP2 Antibody (NBP2-47337)

View related products by pathway.

PTMs for PARP2 Antibody (NBP2-47337)

Learn more about PTMs related to PARP2 Antibody (NBP2-47337).
 

Research Areas for PARP2 Antibody (NBP2-47337)

Find related products by research area.

Blogs on PARP2.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP2