PARP3 Antibody

Western Blot: PARP3 Antibody [NBP2-49523] - Analysis in human cell line U-138MG.

Immunohistochemistry-Paraffin: PARP3 Antibody [NBP2-49523] - Staining of human urinary bladder shows moderate positivity in nucleoli in urothelial cells.

Immunohistochemistry-Paraffin: PARP3 Antibody [NBP2-49523] - Staining of human cerebral cortex shows moderate positivity in nucleoli in neurons.

Immunohistochemistry-Paraffin: PARP3 Antibody [NBP2-49523] - Staining of human kidney shows moderate positivity in nucleoli in cells in tubules.

Immunohistochemistry-Paraffin: PARP3 Antibody [NBP2-49523] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PARP3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PARP3 Recombinant Protein Antigen (NBP2-49523PEP)

Reactivity Notes

Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PARP3 Antibody

• ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 3
• ADPRT3
• ADPRT-3
• ADPRT3PADPRT-3
• ADPRTL2
• ADPRTL3
• ADPRTL3NAD+ ADP-ribosyltransferase 3
• ARTD3
• EC 2.4.2.30
• hPARP-3
• IRT1ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 2
• NAD(+) ADP-ribosyltransferase 3
• pADPRT-3
• PARP3
• PARP-3
• poly (ADP-ribose) polymerase family, member 3
• poly [ADP-ribose] polymerase 3
• poly(ADP-ribose) synthetase-3
• Poly[ADP-ribose] synthase 3
• poly[ADP-ribose] synthetase 3

Background

PARP3 is encoded by this gene belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. This gene encodes the poly(ADP-ribosyl)transferase 3, which is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PARP3 Antibody (NBP2-49523)(2)

Publications using NBP2-49523

• Guo N, Li MZ, Wang LM et al. Repeated treatments of Capan-1 cells with PARP1 and Chk1 inhibitors promote drug resistance, migration and invasion Cancer biology & therapy 2022-12-31 [PMID: 35000525] (WB, Human)
• Chen HD, Guo N, Song SS et al. Novel mutations in BRCA2 intron 11 and overexpression of COX-2 and BIRC3 mediate cellular resistance to PARP inhibitors Am J Cancer Res 2020-09-01 [PMID: 33042619]

Bioinformatics

• Gene Symbol: PARP3