PARP10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PARP10 Antibody [NBP2-57056] - Staining of human cell line MCF7 shows localization to nucleoli, cytosol & vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PARP10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PARP10 Antibody - BSA Free (NBP2-57056) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARP10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PARP10 Recombinant Protein Antigen (NBP2-57056PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PARP10 Antibody - BSA Free

• ARTD10
• EC 2.4.2.30
• FLJ14464
• PARP10
• PARP-10
• poly (ADP-ribose) polymerase family, member 10
• poly [ADP-ribose] polymerase 10

Background

Poly(ADP-ribose) polymerases (PARPs), such as PARP10, regulate gene transcription by altering chromatin organization by adding ADP-ribose to histones. PARPs can also function as transcriptional cofactors (Yu et al., 2005 [PubMed 15674325]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PARP10