Home » ART3 » ART3 Antibodies » ART3 Antibody (3A2)

ART3 Antibody (3A2)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ART3 Antibody (3A2) [H00000419-M05] - Analysis of monoclonal antibody to ART3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 2 ug/ml
Immunohistochemistry-Paraffin: ART3 Antibody (3A2) [H00000419-M05] - Analysis of monoclonal antibody to ART3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 2 ug/ml
ELISA: ART3 Antibody (3A2) [H00000419-M05] - Detection limit for recombinant GST tagged ART3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
3A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ART3 Antibody (3A2) Summary

Immunogen
ART3 (NP_001170, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF
Specificity
ART3 - ADP-ribosyltransferase 3
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ART3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publication using H00000419-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ART3 Antibody (3A2)

  • ADP-ribosyltransferase 3
  • EC 2.4.2.31
  • ecto-ADP-ribosyltransferase 3
  • FLJ26404
  • Mono(ADP-ribosyl)transferase 3
  • mono-ADP-ribosyltransferase
  • NAD(P)(+)--arginine ADP-ribosyltransferase 3
  • TMART

Background

ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases, such as ART3, transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases (see PARG; MIM 603501) reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
Western Blot: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, using this antibody. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
ART2.2/Art2b
Antibody (Nika102) - ...
NB100-65853
Flow Cytometry: ART2.2/Art2b Antibody (Nika102) [NB100-65853] - Staining of C57Bl/6J mouse spleen cells with RAT ANTI MOUSE ART2.2 antibody (NB100-65853).
Species: Mu
Applications: Flow, IP
ART4 Antibody
NBP1-80507
Western Blot: ART4 Antibody [NBP1-80507] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: ART4 Antibody [NBP1-80507] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Species: Hu
Applications: WB
NOB1 Antibody
NBP2-13663
Immunohistochemistry-Paraffin: NOB1 Antibody [NBP2-13663] - Staining of human ovary shows nuclear positivity in ovarian stroma cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
AgRP/ART [HRP]
DAGR00
(1 Review)
(3 Publications)
Species: Hu
Applications: ELISA
GNPDA1 Antibody
NBP2-24653
Western Blot: GNPDA1 Antibody [NBP2-24653] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide 3) mouse spleen and 4) rat spleen using GNPDA1 antibody at 1.0 ug/ml, 0.5 ug/ml and 0.5 ug/ml, respectively.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24653] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Glucose 6 phosphate isomerase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Glucose 6 phosphate isomerase.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Sir2.1 Antibody
NB100-1923
Western Blot: Sir2.1 Antibody [NB100-1923] - Western blot using NB100-1923 against His tagged SIR-2.1 full-length protein.
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
Collagen XI alpha
2 Antibody (473)
NBP2-43728
Immunocytochemistry/Immunofluorescence: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: COL11A2 protein stained by COL11A2 antibody [473] diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Various tissue extracts (50 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with COL11A2 antibody [473] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Analysis of A. 30 ug 293T whole cell lysate/extract B. 30 ug whole cell lysate/extract of human COL11A2-transfected 293T cells (N-terminal fragment of COL11A2 isoform 1) 12 % SDS-PAGE COL11A2 antibody [473] dilution: 1:5000
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Sirtuin 1/SIRT1
Antibody (1F3) - BSA ...
NBP1-51641
Immunohistochemistry-Paraffin: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues (left) and kidney cancer tissues (right) using SIRT1 mouse mAb with DAB staining.
Flow Cytometry: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Flow cytometric analysis of K562 cells using SIRT1 mouse mAb (green) and negative control (purple).
Immunocytochemistry/Immunofluorescence: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Analysis of NTERA-2 cells using SIRT1 mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
(7 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
GAP-43 Antibody
NB300-143
Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Posterior MOE sections at approximately the same region where EOG was recorded were obtained from control and Skn-1a-/- mice exposed to either water or chemicals for 2 wks. The sections were immunoreacted with antibodies against GAP43 and OMP and stained with DAPI. Confocal images were taken from olfactory turbinate II. Similar morphology and marker expression were found in four groups of mice, indicating there was no obvious tissue damage in both control and Skn-1a-/- mice after chemical exposure in the posterior MOE regions where EOG recordings were performed. Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (http://eneuro.sfn.org/lookup/doi/10.1523/ENEURO.0135-17.2017), licensed under a CC-BY licence.
(1 Review)
(82 Publications)
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(12 Reviews)
(191 Publications)
Species: Hu, Mu
Applications: ICC, IHC
LIMPII/SR-B2
Antibody
NB400-129
Western Blot: LIMPII/SR-B2 Antibody [NB400-129] - Detection of LIMP II (~85 kDa) in Lane 1: Rat cardiac fibroblasts (RCF), 3T3 mouse fibroblasts (2), canine lung lysate (3), RCF treated with angiotensin II (4), and H2O2 (5), HEPG2 human liver lysate (6).
Immunohistochemistry: LIMPII/SR-B2 Antibody [NB400-129] - Staining of LIMP II in rat infarctzone tissue with a DAB detection system.
Immunocytochemistry/Immunofluorescence: LIMPII/SR-B2 Antibody [NB400-129] - Detection of LIMPII/lpg85 (Green) in Hela cells using NB400-129. Nuclei (Blue) are counterstained using Hoechst 33258.
(1 Review)
(18 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
eEF-2 Antibody
(4E2Z5)
NBP3-16866
Immunohistochemistry-Paraffin: eEF-2 Antibody (4E2Z5) [NBP3-16866] - Immunohistochemistry of paraffin-embedded human appendix using eEF-2 Rabbit mAb (NBP3-16866) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunocytochemistry/Immunofluorescence: eEF-2 Antibody (4E2Z5) [NBP3-16866] - Immunofluorescence analysis of C6 cells using eEF-2 Rabbit mAb (NBP3-16866) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: eEF-2 Antibody (4E2Z5) [NBP3-16866] - Immunofluorescence analysis of NIH-3T3 cells using eEF-2 Rabbit mAb (NBP3-16866) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Septin-11 Antibody
NBP1-31717
Western Blot: Septin-11 Antibody [NBP1-31717] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Septin-11 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Septin-11 Antibody [NBP1-31717] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Septin-11 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: Septin-11 Antibody [NBP1-31717] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Septin-11 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Integrin alpha 7
Antibody
NBP1-86118
Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Blue (Dapi), Red (Integrin alpha 7), Green (skeletal muscle Myosin). Mononucleated cells containing satellite cells and fibroblasts were isolated from bovine skeletal muscle tissue and induced for myogenic differentiation. Cells were fixed in methanol and stained using anti-myosin antibody and anti-Integrin a7 (#NBP1-86118) antibody. Corresponding secondary antibodies were used to visualize the result. Strong integrin a7 signal was observed in myotubes. But some weaker signals were also observed in fibroblasts which are known to be negative for it. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human heart muscle shows cytoplasmic and membranous positivity in myocytes.
Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
(1 Review)
(1 Publication)
Species: Bv, Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for ART3 Antibody (H00000419-M05)(1)


Reviews for ART3 Antibody (H00000419-M05) (0)

There are no reviews for ART3 Antibody (H00000419-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ART3 Antibody (H00000419-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ART3 Products

Bioinformatics Tool for ART3 Antibody (H00000419-M05)

Discover related pathways, diseases and genes to ART3 Antibody (H00000419-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ART3 Antibody (H00000419-M05)

Discover more about diseases related to ART3 Antibody (H00000419-M05).
 

Pathways for ART3 Antibody (H00000419-M05)

View related products by pathway.

PTMs for ART3 Antibody (H00000419-M05)

Learn more about PTMs related to ART3 Antibody (H00000419-M05).

Blogs on ART3

There are no specific blogs for ART3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ART3 Antibody (3A2) and receive a gift card or discount.


Bioinformatics

Gene Symbol ART3
Entrez
OMIM
Uniprot