Parkin Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: Parkin Antibody [NBP2-68629] - Staining of human cell line SH-SY5Y shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: Parkin Antibody [NBP2-68629] - Staining of human dodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Parkin Antibody [NBP2-68629] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Parkin Antibody [NBP2-68629] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil and neurons.
Immunohistochemistry-Paraffin: Parkin Antibody [NBP2-68629] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Parkin Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKN
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Recommended conditions for ICC/IF: Fixation/Permeabilization: PFA/Triton X-100, Recommended conditions for IHC: Retrieval method: HIER pH6
Control Peptide
Parkin Recombinant Protein Antigen (NBP2-68629PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Parkin Antibody - BSA Free

  • AR-JP
  • E3 ubiquitin ligase
  • E3 ubiquitin-protein ligase parkin
  • EC 6.3.2.-
  • LPRS2
  • PARK2
  • parkin 2
  • Parkin
  • Parkinson disease protein 2
  • Parkinson juvenile disease protein 2
  • parkinson protein 2, E3 ubiquitin protein ligase (parkin)
  • PDJ
  • PDJjuvenile) 2, parkin
  • PRKN

Background

Parkinson's disease is a common neurodegenerative disease with complex clinical features. Mutations in the gene, Parkin (PARK2), appear to be responsible for the pathogenesis of autosomal recessive juvenile Parkinsonism. Parkin plays a role in the ubiquitin-mediated proteolytic pathway by removal and/or detoxification of abnormally folded or damaged protein. Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of Parkin. Parkin may protect neurons against alpha synuclein toxicity, proteasomal dysfunction, gpr37 accumulation, and kainate-induced excitotoxicity. It may play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Parkin also regulates cyclin e during neuronal apoptosis and may represent a tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
BC100-494
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, In vitro, Simple Western, WB
NB300-268
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, WB
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NBP2-55838
Species: Hu
Applications: IHC,  IHC-P
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
MAB7410
Species: Hu
Applications: ICC, KO, Simple Western, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB110-41486
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP2-55955
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-68629
Species: Hu, Mu
Applications: ICC/IF, IHC

Publications for Parkin Antibody (NBP2-68629) (0)

There are no publications for Parkin Antibody (NBP2-68629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Parkin Antibody (NBP2-68629) (0)

There are no reviews for Parkin Antibody (NBP2-68629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Parkin Antibody (NBP2-68629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Parkin Products

Research Areas for Parkin Antibody (NBP2-68629)

Find related products by research area.

Blogs on Parkin.

Understanding Mitophagy Mechanisms: Canonical PINK1/Parkin, LC3-Dependent Piecemeal, and LC3-Independent Mitochondrial Derived Vesicles
By Christina Towers, PhD What is Mitophagy?The selective degradation of mitochondria via double membrane autophagosome vesicles is called mitophagy. Damaged mitochondria can generate harmful amounts of reactive ox...  Read full blog post.

New Players in the Mitophagy Game
By Christina Towers, PhD Mitochondrial turn over via the lysosome, otherwise known as mitophagy, involves engulfment of mitochondria into double membrane autophagosomes and subsequent fusion with lysosomes. Much is al...  Read full blog post.

Optogenetic Control of Mitophagy: AMBRA1 based mitophagy switch
By Christina Towers, PhD Mitophagy in the BrainSelective autophagic degradation of damaged mitochondria, known as mitophagy, has been described as a cyto-protective process. Accordingly, defects in mitophagy h...  Read full blog post.

There's an autophagy for that!
By Christina Towers, PhDA critical mechanism that cells use to generate nutrients and fuel metabolism is through a process called autophagy.  This process is complex and involves over 20 different proteins, most of which are highly conserved acro...  Read full blog post.

The role of Parkin and autophagy in retinal pigment epithelial cell (RPE) degradation
The root of Parkinson’s disease (PD) points to a poorly regulated electron transport chain leading to mitochondrial damage, where many proteins need to work cohesively to ensure proper function.  The two key players of this pathway are PINK1, ...  Read full blog post.

Parkin - Role in Mitochondrial Quality Control and Parkinson's Disease
Parkin/PARK2 is a cytosolic enzyme which gets recruited to cellular mitochondria damaged through depolarization, ROS or unfolded proteins accumulation, and exert protective effects by inducing mitophagy (mitochondrial autophagy). Parkin induces mit...  Read full blog post.

PINK1 - performing mitochondrial quality control and protecting against Parkinson’s disease
PTEN-induced putative kinase 1 (PINK1) is a serine/threonine kinase with important functions in mitochondrial quality control. Together with the Parkin protein, PINK1 is able to regulate the selective degradation of damaged mitochondria through aut...  Read full blog post.

PINK1: All work and no fun
The protein PINK1 is a mitochondrial-located serine/threonine kinase (PTK) that maintains organelle function and integrity. It not only protects organelles from cellular stress, but it also uses the selective auto-phagocytosis process for cleaning and...  Read full blog post.

PINK1: Promoting Organelle Stability and Preventing Parkinson's disease
PINK1 is a protein serine/threonine kinase (PTK) that protects the organelles from cellular stress and controls selective autophagy to clear damage. Exner, et al. were among the first to report that PINK1 deficiency in humans was linked to autosomal r...  Read full blog post.

Novus Antibodies Highlighted in Parkinson's Disease Research
Identified almost two centuries ago, Parkinson's disease is a neurodegenerative disorder that afflicts an estimated 4-6 million worldwide (www.parkinsons.org). The prevalence of Parkinson's disease is expected to grow considerably as the average age o...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Parkin Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKN