Home » Synphilin-1 » Synphilin-1 Antibodies » Synphilin-1 Antibody

Synphilin-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: Synphilin-1 Antibody [NBP2-55955] - Staining of human cell line RT4 shows localization to cytoplasmic bodies.
Immunocytochemistry/ Immunofluorescence: Synphilin-1 Antibody [NBP2-55955] - Staining of human cell line RT4 shows localization to cytoplasmic bodies.
Immunohistochemistry-Paraffin: Synphilin-1 Antibody [NBP2-55955] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Synphilin-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLK
Specificity
Specificity of human Synphilin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNCAIP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Synphilin-1 Recombinant Protein Antigen (NBP2-55955PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Synphilin-1 Antibody

  • Alpha-synuclein-interacting protein
  • MGC39814
  • Sph1
  • synphilin-1
  • synuclein, alpha interacting protein
  • SYPH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

alpha-Synuclein
Antibody
NBP2-15365
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse hippocampus. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: NeuN, stained by NeuN antibody [2Q158] diluted at 1:500.
Western Blot: alpha-Synuclein Antibody [NBP2-15365] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membranes were blotted with alpha Synuclein antibody diluted at 1:2000 and competitor's antibody diluted at 1:2000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse cerebellum. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: beta Tubulin 3/ TUJ1, stained by beta Tubulin 3/ TUJ1 antibody [11710] (NBP2-43559 diluted at 1:500. Blue: Fluoroshield with DAPI.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Human gastric cancer, using DLD antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
(3 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(153 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot: ILT6/CD85e/LILRA3 Antibody (2E9) [H00011026-M01] - Analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.Lane 1: LILRA3 transfected lysate(50.485 KDa).Lane 2: Non-transfected lysate.
(5 Publications)
Species: Hu
Applications: WB, ELISA
Parkin Antibody
[Unconjugated]
AF1438
Western blot shows lysates of Sf 21 S. frugiperda insect ovarian cell line mock transfected or transfected GST tagged Parkin. PVDF membrane was probed with 2 µg/mL of Goat Anti-Human Parkin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1438) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for GST tagged Parkin at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Parkin was detected in immersion fixed paraffin-embedded sections of human brain (cerebellum) using 15 µg/mL Goat Anti-Human Parkin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1438) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC
UCH-L1/PGP9.5
Antibody (31A3)
NB600-1160
Western Blot: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Western Blot Analysis of human brain tissue lysate using UCH-L1/PGP9.5 Antibody (31A3)
Immunocytochemistry/Immunofluorescence: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Immunofluorescence Analysis of T98G cells labeling Pgp9.5 with UCH-L1/PGP9.5 Antibody (31A3) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Nucspot (Red)
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Formalin-fixed, paraffin-embedded human brain stained with UchL1 antibody (PGP9.5) (1:500), peroxidase-conjugate and DAB chromogen. Staining seen in cytoplasm, ER and membrane. Fixation in 95% ethanol/5% acetic acid for 2-3 hours prior to paraffin embedding is recommended. Specimens which have not been fixed in acetic acid/alcohol require pre-treatment with citrate buffer: for example, unmask of the target epitope by boiling the tissue sections in 10mM citrate buffer, pH 6.0, for 10 min followed by cooling at room temp for 20 min.
(1 Review)
(13 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AIMP2 Antibody
NBP1-81575
Western Blot: AIMP2 Antibody [NBP1-81575] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: AIMP2 Antibody [NBP1-81575] - Staining of human cell line A549 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.
Immunohistochemistry-Paraffin: Tau [p Thr181] Antibody [NB100-82245] - analysis of paraffin-embedded rat hippocampal region tissue from a model with Alzheimer's Disease using Tau (phospho-Thr181) antibody.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
14-3-3 Antibody
NBP2-27202
Western Blot: 14-3-3 Antibody [NBP2-27202] - analysis of 14-3-3 using 14-3-3 antibody. Human Brain tissue lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain, and 4) rat brain lysate probed with 2 ug/ml of 14-3-3 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: 14-3-3 Antibody [NBP2-27202] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-14-3-3 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Simple Western: 14-3-3 Antibody [NBP2-27202] - Simple Western lane view shows a specific band for 14-3-3 Gamma in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Review)
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
PARP Antibody
(194C1439) - Cleaved
NB100-56599
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, antibody at 2 ug/mL. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - Cleaved [NB100-56599] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
(8 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
DORFIN Antibody
NBP1-87989
Western Blot: DORFIN Antibody [NBP1-87989] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DORFIN Antibody [NBP1-87989] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: DORFIN Antibody [NBP1-87989] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, IHC, IHC-P
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Dopamine neurons in the mouse substantia nigra. ICC/IF image submitted by a verified customer review.
Simple Western: Tyrosine Hydroxylase Antibody [NB300-109] - Simple Western lane view shows a specific band for Tyrosine Hydroxylase in 0.2 mg/mL of PC-12 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(7 Reviews)
(140 Publications)
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
Prion protein
Antibody (SC57-05)
NBP2-67569
Western Blot: Prion protein Antibody (SC57-05) [NBP2-67569] - Analysis of Prion Protein(PrP) on rat brain tissue lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunocytochemistry/Immunofluorescence: Prion protein Antibody (SC57-05) [NBP2-67569] - Staining PrP in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Prion protein Antibody (SC57-05) [NBP2-67569] - Analysis of paraffin-embedded rat brain tissue using anti-PrP antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Synphilin-1
Antibody
NBP2-55955
Synphilin-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Synphilin-1 Antibody (NBP2-55955) (0)

There are no publications for Synphilin-1 Antibody (NBP2-55955).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synphilin-1 Antibody (NBP2-55955) (0)

There are no reviews for Synphilin-1 Antibody (NBP2-55955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Synphilin-1 Antibody (NBP2-55955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Synphilin-1 Products

Bioinformatics Tool for Synphilin-1 Antibody (NBP2-55955)

Discover related pathways, diseases and genes to Synphilin-1 Antibody (NBP2-55955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synphilin-1 Antibody (NBP2-55955)

Discover more about diseases related to Synphilin-1 Antibody (NBP2-55955).
 

Pathways for Synphilin-1 Antibody (NBP2-55955)

View related products by pathway.

PTMs for Synphilin-1 Antibody (NBP2-55955)

Learn more about PTMs related to Synphilin-1 Antibody (NBP2-55955).
 

Research Areas for Synphilin-1 Antibody (NBP2-55955)

Find related products by research area.

Blogs on Synphilin-1

There are no specific blogs for Synphilin-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synphilin-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SNCAIP