Synphilin-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Synphilin-1 Antibody [NBP2-55955] - Staining of human cell line RT4 shows localization to cytoplasmic bodies.
Immunohistochemistry-Paraffin: Synphilin-1 Antibody [NBP2-55955] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synphilin-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLK
Specificity
Specificity of human Synphilin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNCAIP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Synphilin-1 Recombinant Protein Antigen (NBP2-55955PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Synphilin-1 Antibody

  • Alpha-synuclein-interacting protein
  • MGC39814
  • Sph1
  • synphilin-1
  • synuclein, alpha interacting protein
  • SYPH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF1438
Species: Hu
Applications: WB, IHC
NB600-1160
Species: Hu, Mu, Rt, Po, Bv, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-87989
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55955
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Synphilin-1 Antibody (NBP2-55955) (0)

There are no publications for Synphilin-1 Antibody (NBP2-55955).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synphilin-1 Antibody (NBP2-55955) (0)

There are no reviews for Synphilin-1 Antibody (NBP2-55955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Synphilin-1 Antibody (NBP2-55955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Synphilin-1 Products

Bioinformatics Tool for Synphilin-1 Antibody (NBP2-55955)

Discover related pathways, diseases and genes to Synphilin-1 Antibody (NBP2-55955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synphilin-1 Antibody (NBP2-55955)

Discover more about diseases related to Synphilin-1 Antibody (NBP2-55955).
 

Pathways for Synphilin-1 Antibody (NBP2-55955)

View related products by pathway.

PTMs for Synphilin-1 Antibody (NBP2-55955)

Learn more about PTMs related to Synphilin-1 Antibody (NBP2-55955).
 

Research Areas for Synphilin-1 Antibody (NBP2-55955)

Find related products by research area.

Blogs on Synphilin-1

There are no specific blogs for Synphilin-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synphilin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNCAIP