Pappalysin-1/PAPP-A Antibody

Images

 
Immunohistochemistry-Paraffin: Pappalysin-1/PAPP-A Antibody [NBP1-90087] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Pappalysin-1/PAPP-A Antibody [NBP1-90087] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Pappalysin-1/PAPP-A Antibody [NBP1-90087] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Pappalysin-1/PAPP-A Antibody [NBP1-90087] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pappalysin-1/PAPP-A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAPPA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pappalysin-1/PAPP-A Protein (NBP1-90087PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pappalysin-1/PAPP-A Antibody

  • ASBABP2
  • DIPLA1
  • EC 3.4.24.79
  • IGFBP-4ase
  • IGFBP-4aseaspecific BCL2 ARE-binding protein 2
  • IGF-dependent IGFBP-4 protease
  • insulin-like growth factor-dependent IGF binding protein-4 protease
  • Insulin-like growth factor-dependent IGF-binding protein 4 protease
  • PAPA
  • PAPPA
  • PAPPA1
  • PAPP-A1
  • PAPP-Adifferentially placenta 1 expressed protein
  • Pappalysin1
  • Pappalysin-1
  • pregnacy-associated plasma protein A
  • Pregnancy-associated plasma protein A
  • pregnancy-associated plasma protein A, pappalysin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80549
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PAGE
AF875
Species: Hu
Applications: WB, IHC
NBP2-46376
Species: Hu
Applications: WB, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90087
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Pappalysin-1/PAPP-A Antibody (NBP1-90087) (0)

There are no publications for Pappalysin-1/PAPP-A Antibody (NBP1-90087).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pappalysin-1/PAPP-A Antibody (NBP1-90087) (0)

There are no reviews for Pappalysin-1/PAPP-A Antibody (NBP1-90087). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pappalysin-1/PAPP-A Antibody (NBP1-90087). (Showing 1 - 1 of 1 FAQ).

  1. I am highly interested to use couple of Anti-PAPP-A antibodies from your reputed companies for my research work. I have got the information regarding the immunogen used to generate these antibodies, however could not get any information regarding the specific amino acids/epitope to which your Anti-PAPP-A Antibodies binds with the antigen (PAPP-A).
    • Unfortunately, none of our PAPP A antibodies have been epitope mapped. Many of them have also been generated against full-length PAPP A, so there are many potential binding sites.

Secondary Antibodies

 

Isotype Controls

Additional Pappalysin-1/PAPP-A Products

Bioinformatics Tool for Pappalysin-1/PAPP-A Antibody (NBP1-90087)

Discover related pathways, diseases and genes to Pappalysin-1/PAPP-A Antibody (NBP1-90087). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pappalysin-1/PAPP-A Antibody (NBP1-90087)

Discover more about diseases related to Pappalysin-1/PAPP-A Antibody (NBP1-90087).
 

Pathways for Pappalysin-1/PAPP-A Antibody (NBP1-90087)

View related products by pathway.

PTMs for Pappalysin-1/PAPP-A Antibody (NBP1-90087)

Learn more about PTMs related to Pappalysin-1/PAPP-A Antibody (NBP1-90087).
 

Research Areas for Pappalysin-1/PAPP-A Antibody (NBP1-90087)

Find related products by research area.

Blogs on Pappalysin-1/PAPP-A

There are no specific blogs for Pappalysin-1/PAPP-A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pappalysin-1/PAPP-A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAPPA
Entrez