P-Selectin/CD62P Antibody

Images

 
Immunohistochemistry-Paraffin: CD62P Antibody [NBP1-85744] Staining of human bone marrow shows strong positivity in megakaryocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P-Selectin/CD62P Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SELP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
P-Selectin/CD62P Recombinant Protein Antigen (NBP1-85744PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P-Selectin/CD62P Antibody

  • CD62P antigen
  • CD62P
  • FLJ45155
  • GMP140
  • GRMP
  • PADGEM
  • PADGEMantigen CD62)
  • PSEL
  • P-Selectin
  • selectin P (granule membrane protein 140kDa, antigen CD62)
  • SELP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P

Publications for P-Selectin/CD62P Antibody (NBP1-85744) (0)

There are no publications for P-Selectin/CD62P Antibody (NBP1-85744).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P-Selectin/CD62P Antibody (NBP1-85744) (0)

There are no reviews for P-Selectin/CD62P Antibody (NBP1-85744). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for P-Selectin/CD62P Antibody (NBP1-85744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P-Selectin/CD62P Products

Bioinformatics Tool for P-Selectin/CD62P Antibody (NBP1-85744)

Discover related pathways, diseases and genes to P-Selectin/CD62P Antibody (NBP1-85744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P-Selectin/CD62P Antibody (NBP1-85744)

Discover more about diseases related to P-Selectin/CD62P Antibody (NBP1-85744).
 

Pathways for P-Selectin/CD62P Antibody (NBP1-85744)

View related products by pathway.

PTMs for P-Selectin/CD62P Antibody (NBP1-85744)

Learn more about PTMs related to P-Selectin/CD62P Antibody (NBP1-85744).

Blogs on P-Selectin/CD62P

There are no specific blogs for P-Selectin/CD62P, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P-Selectin/CD62P Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SELP
Entrez