OXSR1 Antibody

Images

 
Western Blot: OXSR1 Antibody [NBP1-82929] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: OXSR1 Antibody [NBP1-82929] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: OXSR1 Antibody [NBP1-82929] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OXSR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FDEESEEGKAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDIRFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OXSR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OXSR1 Protein (NBP1-82929PEP)
Publications
Read Publication using NBP1-82929.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OXSR1 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1101OSR1serine/threonine-protein kinase OSR1
  • Oxidative stress-responsive 1 protein
  • oxidative-stress responsive 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB8528
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56333
Species: Hu
Applications: WB, ICC/IF
NBP1-03340
Species: Hu
Applications: WB, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010736-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi, RNAi SP

Publications for OXSR1 Antibody (NBP1-82929)(1)

Reviews for OXSR1 Antibody (NBP1-82929) (0)

There are no reviews for OXSR1 Antibody (NBP1-82929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OXSR1 Antibody (NBP1-82929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OXSR1 Products

Bioinformatics Tool for OXSR1 Antibody (NBP1-82929)

Discover related pathways, diseases and genes to OXSR1 Antibody (NBP1-82929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OXSR1 Antibody (NBP1-82929)

Discover more about diseases related to OXSR1 Antibody (NBP1-82929).
 

Pathways for OXSR1 Antibody (NBP1-82929)

View related products by pathway.

PTMs for OXSR1 Antibody (NBP1-82929)

Learn more about PTMs related to OXSR1 Antibody (NBP1-82929).
 

Research Areas for OXSR1 Antibody (NBP1-82929)

Find related products by research area.

Blogs on OXSR1

There are no specific blogs for OXSR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OXSR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OXSR1