Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | STK24 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | WB reported in scientific literature (PMID: 27457113). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This MST3 Antibody is validated for ELISA from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Verified Customer |
ELISA | Human | 11/12/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for MST3 Antibody (NBP1-87833)Discover more about diseases related to MST3 Antibody (NBP1-87833).
| Pathways for MST3 Antibody (NBP1-87833)View related products by pathway.
|
PTMs for MST3 Antibody (NBP1-87833)Learn more about PTMs related to MST3 Antibody (NBP1-87833).
| Research Areas for MST3 Antibody (NBP1-87833)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | STK24 |