MST3 Antibody


Independent Antibodies: Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver, skin, small intestine and testis using Anti-STK24 antibody NBP1-87833 (A) shows similar protein more
Independent Antibodies: Western Blot: MST3 Antibody [NBP1-87833] - Analysis using Anti-STK24 antibody NBP1-87833 (A) shows similar pattern to independent antibody NBP1-87834 (B).
Immunocytochemistry/ Immunofluorescence: MST3 Antibody [NBP1-87833] - Staining of human cell line A-431 shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Western Blot: MST3 Antibody [NBP1-87833] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver shows very weak positivity in hepatocytes as expected.
ELISA: MST3 Antibody [NBP1-87833] - MST-3 levels in SH-SY5Y cell lysates. ELISA image added from a verified customer review

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

MST3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 27457113). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This MST3 Antibody is validated for ELISA from a verified customer review.
Control Peptide
MST3 Protein (NBP1-87833PEP)
Reviewed Applications
Read 1 Review rated 4
NBP1-87833 in the following applications:

Read Publications using
NBP1-87833 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MST3 Antibody

  • EC 2.7.11
  • EC
  • Mammalian STE20-like protein kinase 3
  • MST-3
  • MST3serine/threonine kinase 24 (Ste20, yeast homolog)
  • serine/threonine kinase 24
  • serine/threonine-protein kinase 24
  • STE20
  • STE20-like kinase 3
  • STE20-like kinase MST3
  • sterile 20-like kinase 3
  • STK3yeast)


The growth of axons is fundamental to the development and repair of brain circuitry. It has been shown that Mst3, a neuron-specific homolog of the yeast kinase Ste20, is critical for axon outgrowth. Mst3 is activated in response to trophic factors, and suppressing its expression or its function blocks axon outgrowth (1). Mst3 has been recently demonstrated to undergo a caspase-mediated cleavage during apoptosis. The proteolytic cleavage of the C-terminus of Mst3 caused nuclear translocation of its kinase domain. Mst3 contains both nuclear localization sequence (NLS) and NES signals, which may cooperate to control the subcellular distribution of Mst3 (2). In situ hybridization of rat brain sections indicated that MST3b is widely expressed in different brain regions, with especially high expression in hippocampus and cerebral cortex. When expressed in human embryonic kidney 293 (HEK293) cells, MST3b effectively phosphorylated myelin basic protein, as well as undergoing autophosphorylation (3)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: BA, BA
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB

Publications for MST3 Antibody (NBP1-87833)(2)

Review for MST3 Antibody (NBP1-87833) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-87833:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
reviewed by:
Verified Customer
ELISA Human 11/12/2021


Sample TestedSH-SY5Y cell lsyate


Comments***Novus Innovators Program - new species or application used on a primary antibody.***

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MST3 Antibody (NBP1-87833) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MST3 Products

Bioinformatics Tool for MST3 Antibody (NBP1-87833)

Discover related pathways, diseases and genes to MST3 Antibody (NBP1-87833). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MST3 Antibody (NBP1-87833)

Discover more about diseases related to MST3 Antibody (NBP1-87833).

Pathways for MST3 Antibody (NBP1-87833)

View related products by pathway.

PTMs for MST3 Antibody (NBP1-87833)

Learn more about PTMs related to MST3 Antibody (NBP1-87833).

Research Areas for MST3 Antibody (NBP1-87833)

Find related products by research area.

Blogs on MST3

There are no specific blogs for MST3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Verified Customer
Application: ELISA
Species: Human


Gene Symbol STK24