MST3 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver, skin, small intestine and testis using Anti-STK24 antibody NBP1-87833 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: MST3 Antibody [NBP1-87833] - Analysis using Anti-STK24 antibody NBP1-87833 (A) shows similar pattern to independent antibody NBP1-87834 (B).
Immunocytochemistry/ Immunofluorescence: MST3 Antibody [NBP1-87833] - Staining of human cell line A-431 shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Western Blot: MST3 Antibody [NBP1-87833] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver shows very weak positivity in hepatocytes as expected.
ELISA: MST3 Antibody [NBP1-87833] - MST-3 levels in SH-SY5Y cell lysates. ELISA image added from a verified customer review

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

MST3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 27457113). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This MST3 Antibody is validated for ELISA from a verified customer review.
Control Peptide
MST3 Protein (NBP1-87833PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87833 in the following applications:

Publications
Read Publications using
NBP1-87833 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MST3 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • Mammalian STE20-like protein kinase 3
  • MST-3
  • MST3serine/threonine kinase 24 (Ste20, yeast homolog)
  • serine/threonine kinase 24
  • serine/threonine-protein kinase 24
  • STE20
  • STE20-like kinase 3
  • STE20-like kinase MST3
  • sterile 20-like kinase 3
  • STK3yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010494-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB
352-MS/CF
Species: Hu
Applications: BA, BA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB300-815
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00009448-M07
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20401
Species: Hu
Applications: IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00009943-M16
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF5066
Species: Hu
Applications: WB
NBP1-91725
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
H00130497-M10
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB

Publications for MST3 Antibody (NBP1-87833)(2)

Review for MST3 Antibody (NBP1-87833) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-87833:
Filter by Applications
ELISA
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
ELISA MST3 NBP1-87833
Enlarge
4
reviewed by:
Verified Customer
ELISA Human 11/12/2021
View

Summary

ApplicationELISA
Sample TestedSH-SY5Y cell lsyate
SpeciesHuman
Lot14274

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.***

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MST3 Antibody (NBP1-87833) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MST3 Products

Bioinformatics Tool for MST3 Antibody (NBP1-87833)

Discover related pathways, diseases and genes to MST3 Antibody (NBP1-87833). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MST3 Antibody (NBP1-87833)

Discover more about diseases related to MST3 Antibody (NBP1-87833).
 

Pathways for MST3 Antibody (NBP1-87833)

View related products by pathway.

PTMs for MST3 Antibody (NBP1-87833)

Learn more about PTMs related to MST3 Antibody (NBP1-87833).
 

Research Areas for MST3 Antibody (NBP1-87833)

Find related products by research area.

Blogs on MST3

There are no specific blogs for MST3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
11/12/2021
Application: ELISA
Species: Human

Bioinformatics

Gene Symbol STK24