MST3 Antibody

Images

 
Independent Antibodies: Western Blot: MST3 Antibody [NBP1-87833] - Analysis using Anti-STK24 antibody NBP1-87833 (A) shows similar pattern to independent antibody NBP1-87834 (B).
Immunocytochemistry/ Immunofluorescence: MST3 Antibody [NBP1-87833] - Staining of human cell line A-431 shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Western Blot: MST3 Antibody [NBP1-87833] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human testis using Anti-STK24 antibody.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human colon using Anti-STK24 antibody.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human cerebral cortex using Anti-STK24 antibody.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver using Anti-STK24 antibody.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver, skin, small intestine and testis using Anti-STK24 antibody NBP1-87833 (A) shows similar protein distribution across tissues to ...read more
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver shows very weak positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

MST3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS
Specificity
Specificity of human MST3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB reported in scientific literature (PMID: 27457113). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MST3 Protein (NBP1-87833PEP)
Publications
Read Publications using
NBP1-87833 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MST3 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • Mammalian STE20-like protein kinase 3
  • MST-3
  • MST3serine/threonine kinase 24 (Ste20, yeast homolog)
  • serine/threonine kinase 24
  • serine/threonine-protein kinase 24
  • STE20
  • STE20-like kinase 3
  • STE20-like kinase MST3
  • sterile 20-like kinase 3
  • STK3yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32670
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB300-815
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00009448-M07
Species: Hu, Bv, Pa
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20401
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-87737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00130497-M10
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA

Publications for MST3 Antibody (NBP1-87833)(2)

Reviews for MST3 Antibody (NBP1-87833) (0)

There are no reviews for MST3 Antibody (NBP1-87833). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MST3 Antibody (NBP1-87833) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MST3 Products

Bioinformatics Tool for MST3 Antibody (NBP1-87833)

Discover related pathways, diseases and genes to MST3 Antibody (NBP1-87833). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MST3 Antibody (NBP1-87833)

Discover more about diseases related to MST3 Antibody (NBP1-87833).
 

Pathways for MST3 Antibody (NBP1-87833)

View related products by pathway.

PTMs for MST3 Antibody (NBP1-87833)

Learn more about PTMs related to MST3 Antibody (NBP1-87833).
 

Research Areas for MST3 Antibody (NBP1-87833)

Find related products by research area.

Blogs on MST3

There are no specific blogs for MST3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MST3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK24