OX40/TNFRSF4 Antibody - BSA Free

Western Blot: OX40/TNFRSF4 Antibody [NBP1-69156] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OX40/TNFRSF4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TNFRSF4 (tumor necrosis factor receptor superfamily, member 4) The peptide sequence was selected from the middle region of TNFRSF4. Peptide sequence GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNFRSF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OX40/TNFRSF4 Antibody - BSA Free

• ACT-135
• ACT35 antigen
• ACT35ATC35 antigen
• CD134 antigen
• CD134
• Ly-70
• OX40 cell surface antigen
• OX40 homologue
• OX40
• OX40L receptor
• OX40lymphoid activation antigene ACT35
• TAX transcriptionally-activated glycoprotein 1 receptor
• tax-transcriptionally activated glycoprotein 1 receptor
• TNFRSF4
• tumor necrosis factor receptor superfamily member 4
• tumor necrosis factor receptor superfamily, member 4
• Txgp1
• TXGP1L
• TXGP1LOX40 antigen

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNFRSF4
• Uniprot:
  • P43489()