OX40/TNFRSF4 Antibody


Western Blot: OX40/TNFRSF4 Antibody [NBP1-69156] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

OX40/TNFRSF4 Antibody Summary

Synthetic peptides corresponding to TNFRSF4 (tumor necrosis factor receptor superfamily, member 4) The peptide sequence was selected from the middle region of TNFRSF4. Peptide sequence GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against TNFRSF4 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
27 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OX40/TNFRSF4 Antibody

  • ACT-135
  • ACT35 antigen
  • ACT35ATC35 antigen
  • CD134 antigen
  • CD134
  • OX40 cell surface antigen
  • OX40 homologue
  • OX40L receptor
  • OX40lymphoid activation antigene ACT35
  • TAX transcriptionally-activated glycoprotein 1 receptor
  • tax-transcriptionally activated glycoprotein 1 receptor
  • tumor necrosis factor receptor superfamily member 4
  • tumor necrosis factor receptor superfamily, member 4
  • TXGP1LOX40 antigen


The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, AgAct, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, Flow, AgAct
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB, AgAct

Publications for OX40/TNFRSF4 Antibody (NBP1-69156) (0)

There are no publications for OX40/TNFRSF4 Antibody (NBP1-69156).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OX40/TNFRSF4 Antibody (NBP1-69156) (0)

There are no reviews for OX40/TNFRSF4 Antibody (NBP1-69156). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OX40/TNFRSF4 Antibody (NBP1-69156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OX40/TNFRSF4 Antibody Products

Related Products by Gene

Bioinformatics Tool for OX40/TNFRSF4 Antibody (NBP1-69156)

Discover related pathways, diseases and genes to OX40/TNFRSF4 Antibody (NBP1-69156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OX40/TNFRSF4 Antibody (NBP1-69156)

Discover more about diseases related to OX40/TNFRSF4 Antibody (NBP1-69156).

Pathways for OX40/TNFRSF4 Antibody (NBP1-69156)

View related products by pathway.

PTMs for OX40/TNFRSF4 Antibody (NBP1-69156)

Learn more about PTMs related to OX40/TNFRSF4 Antibody (NBP1-69156).

Research Areas for OX40/TNFRSF4 Antibody (NBP1-69156)

Find related products by research area.

Blogs on OX40/TNFRSF4

There are no specific blogs for OX40/TNFRSF4, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol TNFRSF4

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69156 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought