OX40/TNFRSF4 Antibody

Images

 
Western Blot: OX40/TNFRSF4 Antibody [NBP1-69156] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OX40/TNFRSF4 Antibody Summary

Immunogen
Synthetic peptides corresponding to TNFRSF4 (tumor necrosis factor receptor superfamily, member 4) The peptide sequence was selected from the middle region of TNFRSF4. Peptide sequence GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFRSF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TNFRSF4 and was validated on Western blot.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OX40/TNFRSF4 Antibody

  • ACT-135
  • ACT35 antigen
  • ACT35ATC35 antigen
  • CD134 antigen
  • CD134
  • Ly-70
  • OX40 cell surface antigen
  • OX40 homologue
  • OX40
  • OX40L receptor
  • OX40lymphoid activation antigene ACT35
  • TAX transcriptionally-activated glycoprotein 1 receptor
  • tax-transcriptionally activated glycoprotein 1 receptor
  • TNFRSF4
  • tumor necrosis factor receptor superfamily member 4
  • tumor necrosis factor receptor superfamily, member 4
  • Txgp1
  • TXGP1L
  • TXGP1LOX40 antigen

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF382
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF838
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB342
Species: Hu
Applications: WB, AgAct
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for OX40/TNFRSF4 Antibody (NBP1-69156) (0)

There are no publications for OX40/TNFRSF4 Antibody (NBP1-69156).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OX40/TNFRSF4 Antibody (NBP1-69156) (0)

There are no reviews for OX40/TNFRSF4 Antibody (NBP1-69156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OX40/TNFRSF4 Antibody (NBP1-69156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OX40/TNFRSF4 Products

Bioinformatics Tool for OX40/TNFRSF4 Antibody (NBP1-69156)

Discover related pathways, diseases and genes to OX40/TNFRSF4 Antibody (NBP1-69156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OX40/TNFRSF4 Antibody (NBP1-69156)

Discover more about diseases related to OX40/TNFRSF4 Antibody (NBP1-69156).
 

Pathways for OX40/TNFRSF4 Antibody (NBP1-69156)

View related products by pathway.

PTMs for OX40/TNFRSF4 Antibody (NBP1-69156)

Learn more about PTMs related to OX40/TNFRSF4 Antibody (NBP1-69156).
 

Research Areas for OX40/TNFRSF4 Antibody (NBP1-69156)

Find related products by research area.

Blogs on OX40/TNFRSF4

There are no specific blogs for OX40/TNFRSF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OX40/TNFRSF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF4
Entrez
Uniprot