OTOS Antibody

Images

 
Western Blot: OTOS Antibody [NBP1-57031] - Jurkat cell lysate.

Product Details

Summary
Reactivity Hu, Rt, Po, Bv, Ca, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OTOS Antibody Summary

Immunogen
Synthetic peptides corresponding to OTOS (otospiralin) The peptide sequence was selected from the N terminal of OTOS. Peptide sequence MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTOS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OTOS Antibody

  • OTOSP
  • otospiralin

Background

OTOS may be essential for the survival of the neurosensory epithelium of the inner ear.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84545
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF5535
Species: Hu
Applications: WB, Simple Western
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready, KO
H00001678-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41292
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-402
Species: Hu, Mu, Rt, Po, Ca, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP1-57031
Species: Hu, Rt, Po, Bv, Ca, Eq
Applications: WB

Publications for OTOS Antibody (NBP1-57031) (0)

There are no publications for OTOS Antibody (NBP1-57031).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTOS Antibody (NBP1-57031) (0)

There are no reviews for OTOS Antibody (NBP1-57031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OTOS Antibody (NBP1-57031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OTOS Products

Array NBP1-57031

Bioinformatics Tool for OTOS Antibody (NBP1-57031)

Discover related pathways, diseases and genes to OTOS Antibody (NBP1-57031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTOS Antibody (NBP1-57031)

Discover more about diseases related to OTOS Antibody (NBP1-57031).
 

Pathways for OTOS Antibody (NBP1-57031)

View related products by pathway.

Blogs on OTOS

There are no specific blogs for OTOS, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OTOS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTOS
Uniprot