CENPV Antibody

Images

 
Western Blot: CENPV Antibody [NBP1-84546] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84546] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Western Blot: CENPV Antibody [NBP1-84546] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPV Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPV
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CENPV Protein (NBP1-84546PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CENPV Antibody

  • 3110013H01Rik
  • CENP-VPRR6
  • centromere protein V
  • Nuclear protein p30
  • p30
  • proline rich 6
  • Proline-rich protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NBP2-49672
Species: Hu
Applications: IHC
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13469
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP1-84546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CENPV Antibody (NBP1-84546) (0)

There are no publications for CENPV Antibody (NBP1-84546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPV Antibody (NBP1-84546) (0)

There are no reviews for CENPV Antibody (NBP1-84546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPV Antibody (NBP1-84546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CENPV Products

Bioinformatics Tool for CENPV Antibody (NBP1-84546)

Discover related pathways, diseases and genes to CENPV Antibody (NBP1-84546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPV Antibody (NBP1-84546)

Discover more about diseases related to CENPV Antibody (NBP1-84546).

Blogs on CENPV

There are no specific blogs for CENPV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPV Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPV