Otoraplin/OTOR Antibody

Images

 
Western Blot: OTOR Antibody [NBP1-83912] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: OTOR Antibody [NBP1-83912] - Staining of human appendix shows distinct cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Otoraplin/OTOR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTOR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Otoraplin/OTOR Protein (NBP1-83912PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Otoraplin/OTOR Antibody

  • FDPMelanoma inhibitory activity-like protein
  • Fibrocyte-derived protein
  • MGC126739
  • MIAL1
  • MIALMGC126737
  • OTOR
  • Otoraplin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2050
Species: Hu
Applications: WB, IHC
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
AF1267
Species: Hu
Applications: WB, IP, Neut
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF842
Species: Hu
Applications: WB
NBP2-34986
Species: Hu
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89602
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Otoraplin/OTOR Antibody (NBP1-83912) (0)

There are no publications for Otoraplin/OTOR Antibody (NBP1-83912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Otoraplin/OTOR Antibody (NBP1-83912) (0)

There are no reviews for Otoraplin/OTOR Antibody (NBP1-83912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Otoraplin/OTOR Antibody (NBP1-83912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Otoraplin/OTOR Products

Bioinformatics Tool for Otoraplin/OTOR Antibody (NBP1-83912)

Discover related pathways, diseases and genes to Otoraplin/OTOR Antibody (NBP1-83912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Otoraplin/OTOR Antibody (NBP1-83912)

Discover more about diseases related to Otoraplin/OTOR Antibody (NBP1-83912).
 

Pathways for Otoraplin/OTOR Antibody (NBP1-83912)

View related products by pathway.

Blogs on Otoraplin/OTOR

There are no specific blogs for Otoraplin/OTOR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Otoraplin/OTOR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTOR
Entrez