TIMM8A Antibody (2F11)

Images

 
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - TIMM8A monoclonal antibody (M01), clone 2F11 Analysis of TIMM8A expression in HeLa.
Immunohistochemistry-Paraffin: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11.Lane 1: TIMM8A transfected lysate(11 KDa).Lane 2: ...read more
Sandwich ELISA: TIMM8A Antibody (2F11) [H00001678-M01] - Detection limit for recombinant GST tagged TIMM8A is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TIMM8A Antibody (2F11) Summary

Immunogen
TIMM8A (NP_004076, 9 a.a. - 97 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Specificity
TIMM8A - translocase of inner mitochondrial membrane 8 homolog A (yeast)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TIMM8A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM8A Antibody (2F11)

  • DDP1deafness/dystonia peptide
  • DDPMGC12262
  • Deafness dystonia protein 1
  • DFN1
  • mitochondrial import inner membrane translocase subunit Tim8 A
  • MTSTIM8
  • TIM8A
  • translocase of inner mitochondrial membrane 8 (yeast) homolog A
  • translocase of inner mitochondrial membrane 8 homolog A (yeast)
  • X-linked deafness dystonia protein

Background

This translocase has similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Deafness Dystonia Syndrome (MTS/DFN-1) and it is postulated that MTS/DFN-1 is a mitochondrial disease caused by a defective mitochondrial protein import system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF6108
Species: Hu
Applications: IHC
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for TIMM8A Antibody (H00001678-M01) (0)

There are no publications for TIMM8A Antibody (H00001678-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM8A Antibody (H00001678-M01) (0)

There are no reviews for TIMM8A Antibody (H00001678-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIMM8A Antibody (H00001678-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIMM8A Products

Bioinformatics Tool for TIMM8A Antibody (H00001678-M01)

Discover related pathways, diseases and genes to TIMM8A Antibody (H00001678-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM8A Antibody (H00001678-M01)

Discover more about diseases related to TIMM8A Antibody (H00001678-M01).
 

Pathways for TIMM8A Antibody (H00001678-M01)

View related products by pathway.

PTMs for TIMM8A Antibody (H00001678-M01)

Learn more about PTMs related to TIMM8A Antibody (H00001678-M01).
 

Research Areas for TIMM8A Antibody (H00001678-M01)

Find related products by research area.

Blogs on TIMM8A

There are no specific blogs for TIMM8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM8A Antibody (2F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM8A
Entrez
OMIM
Uniprot