TIMM8A Antibody (2F11) - Azide and BSA Free

Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11.Lane 1: TIMM8A transfected lysate(11 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.

Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - TIMM8A monoclonal antibody (M01), clone 2F11 Analysis of TIMM8A expression in HeLa.

Sandwich ELISA: TIMM8A Antibody (2F11) [H00001678-M01] - Detection limit for recombinant GST tagged TIMM8A is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 2F11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TIMM8A Antibody (2F11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TIMM8A (NP_004076, 9 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
• Specificity: TIMM8A - translocase of inner mitochondrial membrane 8 homolog A (yeast)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TIMM8A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM8A Antibody (2F11) - Azide and BSA Free

• DDP1deafness/dystonia peptide
• DDPMGC12262
• Deafness dystonia protein 1
• DFN1
• mitochondrial import inner membrane translocase subunit Tim8 A
• MTSTIM8
• TIM8A
• translocase of inner mitochondrial membrane 8 (yeast) homolog A
• translocase of inner mitochondrial membrane 8 homolog A (yeast)
• X-linked deafness dystonia protein

Background

This translocase has similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Deafness Dystonia Syndrome (MTS/DFN-1) and it is postulated that MTS/DFN-1 is a mitochondrial disease caused by a defective mitochondrial protein import system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TIMM8A Antibody (H00001678-M01)(1)

Publication using H00001678-M01

• Braun F, Abed A, Sellung D et al. Accumulation of ?-synuclein mediates podocyte injury in Fabry nephropathy The Journal of clinical investigation 2023-06-01 [PMID: 37014703] (WB, Human)

Bioinformatics

• Gene Symbol: TIMM8A
• Entrez:
  • 1678(Human)
• OMIM:
  • 300(Human)
• Uniprot:
  • NP_004076(Human)