Home » TIMM8A » TIMM8A Antibodies » TIMM8A Antibody (2F11)

TIMM8A Antibody (2F11)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - TIMM8A monoclonal antibody (M01), clone 2F11 Analysis of TIMM8A expression in HeLa.
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - TIMM8A monoclonal antibody (M01), clone 2F11 Analysis of TIMM8A expression in HeLa.
Immunohistochemistry-Paraffin: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11.Lane 1: TIMM8A transfected lysate(11 KDa).Lane 2: ...read more
Sandwich ELISA: TIMM8A Antibody (2F11) [H00001678-M01] - Detection limit for recombinant GST tagged TIMM8A is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TIMM8A Antibody (2F11) Summary

Immunogen
TIMM8A (NP_004076, 9 a.a. - 97 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Specificity
TIMM8A - translocase of inner mitochondrial membrane 8 homolog A (yeast)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TIMM8A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM8A Antibody (2F11)

  • DDP1deafness/dystonia peptide
  • DDPMGC12262
  • Deafness dystonia protein 1
  • DFN1
  • mitochondrial import inner membrane translocase subunit Tim8 A
  • MTSTIM8
  • TIM8A
  • translocase of inner mitochondrial membrane 8 (yeast) homolog A
  • translocase of inner mitochondrial membrane 8 homolog A (yeast)
  • X-linked deafness dystonia protein

Background

This translocase has similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Deafness Dystonia Syndrome (MTS/DFN-1) and it is postulated that MTS/DFN-1 is a mitochondrial disease caused by a defective mitochondrial protein import system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Western Blot Image of anti-Caspase 3 (31A1067). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 in multiple human tissues. The tissues shown are A) brain, B) heart, C) intestine, D) kidney, E) liver, F) lung, G) muscle, H) stomach, I) spleen, J) ovary, and K) testis.
(1 Review)
(113 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with scrambled control siRNA (lane 1) or Bcl-2 siRNA (lane2). Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - WB analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(494 Publications)
Species: Hu
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MDR1/ABCB1 Antibody
NB100-80870
Western Blot: MDR1/ABCB1 Antibody [NB100-80870] - Analyis of anti-ABCB1 antibody shows detection of ABCB1 in crude membrane extracts from HF insect cells over-expressing human ABCB1. The extract was loaded onto a gel in the amounts indicated followed by electrophoresis and transfer to nitrocellulose. The membrane was probed with the primary antibody diluted to 1:600, followed by Peroxidase Conjugated Affinity Purified Anti-RABBIT IgG at 1:10000. Personal Communication, Anna Calcagno, CCR-NCI, Bethesda, MD.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody [NB100-80870] - Staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
(1 Review)
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Bax Antibody (6A7)
NBP1-28566
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Total cell lysates from NIH/3T3 cells were resolved by electrophoresis, transferred to PVDF membrane, and probled with Mouse Anti-Bax UNLB.
Immunohistochemistry-Frozen: Bax Antibody (6A7) [NBP1-28566] - Mouse retina with no pretreatment
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Analysis of lysates from human metastatic pancreatic cancer cell line L3.6pl using Bax Antibody (clone 6A7; Lot # B168-P780E). This image was submitted via reviews by a varified end user.
(3 Reviews)
(3 Publications)
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
EGFR Antibody
[Unconjugated]
AF231
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A431 human epithelial carcinoma cell line was stained with Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(7 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
TIMM13 Antibody
NBP2-13431
Western Blot: TIMM13 Antibody [NBP2-13431] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: TIMM13 Antibody [NBP2-13431] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center & mitochondria.
Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PARP Antibody
NBP2-13732
Western Blot: PARP Antibody [NBP2-13732] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: PARP Antibody [NBP2-13732] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining in human lymph node and pancreas tissues. Corresponding PARP1 RNA-seq data are presented for the same tissues.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Adrenomedullin/ADM
Antibody [Unconjugate ...
AF6108
Adrenomedullin/ADM was detected in immersion fixed paraffin-embedded sections of human heart using Goat Anti-Human Adrenomedullin/ADM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6108) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: IHC
MCAT Antibody
NBP1-83936
Western Blot: MCAT Antibody [NBP1-83936] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MCAT Antibody [NBP1-83936] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: WB, IHC, IHC-P
Bcl-xL Antibody
NB100-56104
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in Daoy whole cell lysate using anti-Bcl-xL antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Bcl-Xl Antibody [NB100-56104] - Formalin-fixed paraffin-embedded sections of human epidermis stained for Bcl-X expression using this antibody at the bottom of the images were negative for Bcl-X expression. The adjacent stratum spinosum and middle stratum granulosum layers were both very positive for Bcl-X expression. The top stratum corneum consisting mainly of dead or peeling cells were both negative for Bcl-X expression.
Western Blot: Bcl-Xl Antibody [NB100-56104] - Analysis of Bcl-X in lysates from isolated rat liver mitochondria using this antibody. The antibody detected Bcl-XL at ~30 kDa.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(4 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for TIMM8A Antibody (H00001678-M01) (0)

There are no publications for TIMM8A Antibody (H00001678-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM8A Antibody (H00001678-M01) (0)

There are no reviews for TIMM8A Antibody (H00001678-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIMM8A Antibody (H00001678-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIMM8A Products

Bioinformatics Tool for TIMM8A Antibody (H00001678-M01)

Discover related pathways, diseases and genes to TIMM8A Antibody (H00001678-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM8A Antibody (H00001678-M01)

Discover more about diseases related to TIMM8A Antibody (H00001678-M01).
 

Pathways for TIMM8A Antibody (H00001678-M01)

View related products by pathway.

PTMs for TIMM8A Antibody (H00001678-M01)

Learn more about PTMs related to TIMM8A Antibody (H00001678-M01).
 

Research Areas for TIMM8A Antibody (H00001678-M01)

Find related products by research area.

Blogs on TIMM8A

There are no specific blogs for TIMM8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM8A Antibody (2F11) and receive a gift card or discount.


Bioinformatics

Gene Symbol TIMM8A
Entrez
OMIM
Uniprot