Osteopontin/OPN Antibody

Images

 
Western Blot: Osteopontin/OPN Antibody [NBP1-89952] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: Osteopontin/OPN Antibody [NBP1-89952] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Osteopontin/OPN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Osteopontin/OPN Protein (NBP1-89952PEP)
Publications
Read Publication using NBP1-89952.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Osteopontin/OPN Antibody

  • BNSP
  • Bone sialoprotein 1
  • Eta-1
  • MGC110940
  • Nephropontin
  • OPN
  • Osteopontin
  • secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1)
  • secreted phosphoprotein-1 (osteopontin, bone sialoprotein)
  • Spp1
  • SPP-1
  • SPP1/CALPHA1 fusion
  • Urinary stone protein
  • uropontin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
NBP1-89952
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Osteopontin/OPN Antibody (NBP1-89952)(1)

Reviews for Osteopontin/OPN Antibody (NBP1-89952) (0)

There are no reviews for Osteopontin/OPN Antibody (NBP1-89952). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Osteopontin/OPN Antibody (NBP1-89952) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Osteopontin/OPN Products

Bioinformatics Tool for Osteopontin/OPN Antibody (NBP1-89952)

Discover related pathways, diseases and genes to Osteopontin/OPN Antibody (NBP1-89952). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteopontin/OPN Antibody (NBP1-89952)

Discover more about diseases related to Osteopontin/OPN Antibody (NBP1-89952).
 

Pathways for Osteopontin/OPN Antibody (NBP1-89952)

View related products by pathway.

PTMs for Osteopontin/OPN Antibody (NBP1-89952)

Learn more about PTMs related to Osteopontin/OPN Antibody (NBP1-89952).
 

Research Areas for Osteopontin/OPN Antibody (NBP1-89952)

Find related products by research area.

Blogs on Osteopontin/OPN

There are no specific blogs for Osteopontin/OPN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Osteopontin/OPN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPP1
Entrez