Osteopontin/OPN Antibody - BSA Free

Western Blot: Osteopontin/OPN Antibody [NBP1-59190] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml

Immunohistochemistry-Paraffin: Osteopontin/OPN Antibody [NBP1-59190] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: Osteopontin/OPN Antibody [NBP1-59190] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Osteopontin/OPN Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SPP1 (secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)) The peptide sequence was selected from the C terminal of SPP1 (NP_000573). Peptide sequence DSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASS The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 26770207).
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Osteopontin/OPN Antibody - BSA Free

• BNSP
• Bone sialoprotein 1
• Eta-1
• MGC110940
• Nephropontin
• OPN
• Osteopontin
• secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1)
• secreted phosphoprotein-1 (osteopontin, bone sialoprotein)
• Spp1
• SPP-1
• SPP1/CALPHA1 fusion
• Urinary stone protein
• uropontin

Background

The SPP1 gene encodes an acidic matrix protein, mainly expressed in mineralized tissues, kidney and atherosclerotic vessels. This protein also contributes to several steps in the process of prostate carcinogenesis and metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Osteopontin/OPN Antibody (NBP1-59190)(3)

Publications using NBP1-59190

• Fainor M, Mahindroo S, Betz KR et al. A Tunable Calcium Phosphate Coating to Drive in vivo Osseointegration of Composite Engineered Tissues Cells, tissues, organs 2023-03-24 [PMID: 36966531]
• Hadas R, Gershon E, Cohen A et al. Production of Hyaluronan by the Trophectoderm is a Prerequisite for Mouse Blastocyst Attachment bioRxiv 2020-01-01 (IHC-P, Mouse)
• Vicari L, Calabrese G, Forte S, Giuffrida R. Potential Role of Activating Transcription Factor 5 during Osteogenesis. Stem Cells Int 2016-01-16 [PMID: 26770207]

FAQs for Osteopontin/OPN Antibody (NBP1-59190). (Showing 1 - 1 of 1 FAQs).

1. I ordered this antibody and used it to detect osteopontin isolated from bovine milk. Three bands were detected when this antibody was used and one intense band showed similar molecular weight with casein. Since casein is abundant in milk, I am wondering if this osteopontin antibody has been tested to cross react with other proteins?
   • The immunogen for this antibody shows no similarity with casein, so is not predicted to cross-react. It hasn't been directly tested for this, but no other proteins show up in a BLAST of the immunogen, so most likely this is something that is uncharacterized.

Bioinformatics

• Gene Symbol: SPP1
• Entrez:
  • 6696(Human)
• Uniprot:
  • P10451-2(Human)