Ornithine Decarboxylase Antibody (5R7V10) Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ornithine Decarboxylase (P11926).
Sequence: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQS |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
ODC1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
51 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Ornithine Decarboxylase Antibody (5R7V10)
Background
Ornithine Decarboxylase encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Bv, Ch, Gt, Hu, Mu, Po, Rt, Xp
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: WB, ELISA
Publications for Ornithine Decarboxylase Antibody (NBP3-33532) (0)
There are no publications for Ornithine Decarboxylase Antibody (NBP3-33532).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ornithine Decarboxylase Antibody (NBP3-33532) (0)
There are no reviews for Ornithine Decarboxylase Antibody (NBP3-33532).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ornithine Decarboxylase Antibody (NBP3-33532) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ornithine Decarboxylase Products
Research Areas for Ornithine Decarboxylase Antibody (NBP3-33532)
Find related products by research area.
|
Blogs on Ornithine Decarboxylase