Ornithine Decarboxylase Antibody (5R7V10)

Western Blot: Ornithine Decarboxylase Antibody (5R7V10) [NBP3-33532] - Western blot analysis of lysates from U-937 cells, using Ornithine Decarboxylase Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5R7V10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Ornithine Decarboxylase Antibody (5R7V10) Summary

• Description: Novus Biologicals Rabbit Ornithine Decarboxylase Antibody (5R7V10) (NBP3-33532) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ornithine Decarboxylase (P11926).
  
  Sequence:
  MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ODC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ornithine Decarboxylase Antibody (5R7V10)

• ODC
• ODC1
• ODCEC 4.1.1.17
• ornithine decarboxylase 1
• ornithine decarboxylase

Background

Ornithine Decarboxylase encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ODC1