SRM Antibody

Images

 
Western Blot: SRM Antibody [NBP1-80726] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: SRM Antibody [NBP1-80726] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SRM Antibody [NBP1-80726] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEF
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
SRM Protein (NBP1-80726PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRM Antibody

  • EC 2.5.1
  • EC 2.5.1.16
  • Putrescine aminopropyltransferase
  • SPDSY
  • spermidine synthase
  • spermidine synthase-1
  • SPS1PAPT
  • SRML1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-00900
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF1107
Species: Mu
Applications: IHC, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
NBP2-98675
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
NB100-1598
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-82493
Species: Hu
Applications: IHC, IHC-P, WB
DY1747
Species: Hu
Applications: ELISA
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KO, PAGE, WB
H00004830-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SRM Antibody (NBP1-80726) (0)

There are no publications for SRM Antibody (NBP1-80726).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRM Antibody (NBP1-80726) (0)

There are no reviews for SRM Antibody (NBP1-80726). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SRM Antibody (NBP1-80726) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRM Products

Bioinformatics Tool for SRM Antibody (NBP1-80726)

Discover related pathways, diseases and genes to SRM Antibody (NBP1-80726). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRM Antibody (NBP1-80726)

Discover more about diseases related to SRM Antibody (NBP1-80726).
 

Pathways for SRM Antibody (NBP1-80726)

View related products by pathway.

PTMs for SRM Antibody (NBP1-80726)

Learn more about PTMs related to SRM Antibody (NBP1-80726).
 

Research Areas for SRM Antibody (NBP1-80726)

Find related products by research area.

Blogs on SRM

There are no specific blogs for SRM, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRM
Entrez
Uniprot