Optineurin Recombinant Protein Antigen

Images

 
There are currently no images for Optineurin Protein (NBP1-84683PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Optineurin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OPTN.

Source: E. coli

Amino Acid Sequence: LELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OPTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84683.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Optineurin Recombinant Protein Antigen

  • ALS12
  • FIP2
  • FIP2FIP-2
  • GLC1E
  • GLC1Eglaucoma 1, open angle, E (adult-onset)
  • HIP7
  • HIP7ALS12
  • Huntingtin interacting protein L
  • Huntingtin yeast partner L
  • Huntingtin-interacting protein 7
  • Huntingtin-interacting protein L
  • HYPL
  • HYPLHIP-7
  • NEMO-related protein
  • NRP
  • NRPE3-14.7K-interacting protein
  • Optic neuropathy-inducing protein
  • Optineurin
  • OPTN
  • TFIIIA-INTP
  • Transcription factor IIIA-interacting protein
  • transcrption factor IIIA-interacting protein
  • tumor necrosis factor alpha-inducible cellular protein containing leucinezipper domains

Background

Optineurin encodes the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
DVE00
Species: Hu
Applications: ELISA
AF567
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
H00134430-M01
Species: Ch, Hu, Pm, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
AF7109
Species: Mu
Applications: IHC, WB
H00004218-M02
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP1-82527
Species: Hu
Applications: IHC,  IHC-P
NBP2-24722
Species: Hu
Applications: IHC,  IHC-P, In vitro, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC,  IHC-P, IP, KD, WB
AF1436
Species: Mu
Applications: WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP1-84683PEP
Species: Hu
Applications: AC

Publications for Optineurin Protein (NBP1-84683PEP) (0)

There are no publications for Optineurin Protein (NBP1-84683PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Optineurin Protein (NBP1-84683PEP) (0)

There are no reviews for Optineurin Protein (NBP1-84683PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Optineurin Protein (NBP1-84683PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Optineurin Products

Research Areas for Optineurin Protein (NBP1-84683PEP)

Find related products by research area.

Blogs on Optineurin

There are no specific blogs for Optineurin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Optineurin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OPTN