OAT Antibody - BSA Free

Immunohistochemistry: OAT Antibody [NBP3-38234] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using OAT Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: OAT Antibody [NBP3-38234] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using OAT Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunoprecipitation: OAT Antibody [NBP3-38234] - Immunoprecipitation analysis of 200 ug extracts of MCF-7 cells, using 3 ug OAT antibody. Western blot was performed from the immunoprecipitate using OAT antibody at a dilution of 1:1000.

Western Blot: OAT Antibody [NBP3-38234] - Western Blot analysis of various lysates using OAT Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Negative control (NC): RT4.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OAT Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OAT Antibody - BSA Free (NBP3-38234) is a polyclonal antibody validated for use in IHC, WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-439 of human OAT (NP_000265.1).
  
  Sequence:
  VKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OAT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for OAT Antibody - BSA Free

• GACR
• HOGA
• OAT ornithine aminotransferase
• OATASE
• OKT

Background

OAT, also known as mitochondrial enzyme ornithine aminotransferase, is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. ( L-ornithine + a 2-oxo acid = L-glutamate 5-semialdehyde + an L-amino acid.) Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Recombinant OAT protein was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OAT