O-GlcNAcase/OGA/MGEA5 Antibody

Images

 
Western Blot: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia in seminiferus ducts.
Immunohistochemistry-Paraffin: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

O-GlcNAcase/OGA/MGEA5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVM
Specificity
Specificity of human O-GlcNAcase/OGA/MGEA5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OGA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
O-GlcNAcase/OGA/MGEA5 Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for O-GlcNAcase/OGA/MGEA5 Antibody

  • bifunctional protein NCOAT
  • FLJ11229
  • GH84
  • HEXC
  • HEXC3
  • Hexosaminidase B
  • hyaluronidase in meningioma
  • KIAA0679
  • MEA5FLJ23355
  • meningioma expressed antigen 5 (hyaluronidase)
  • Meningioma-expressed antigen 5
  • MGEA5
  • NCOAT
  • Nuclear cytoplasmic O-GlcNAcase and acetyltransferase
  • OGA
  • OGlcNAcase
  • O-GlcNAcase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32791
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, Tumorsphere
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-69565
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, IHC, IHC-P
NB100-82001
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF2200
Species: Hu
Applications: WB, IP
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
H00007884-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NBP2-14977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP1-81244
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244) (0)

There are no publications for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244) (0)

There are no reviews for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional O-GlcNAcase/OGA/MGEA5 Products

Bioinformatics Tool for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244)

Discover related pathways, diseases and genes to O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244)

Discover more about diseases related to O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244).
 

Pathways for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244)

View related products by pathway.

PTMs for O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244)

Learn more about PTMs related to O-GlcNAcase/OGA/MGEA5 Antibody (NBP1-81244).

Blogs on O-GlcNAcase/OGA/MGEA5

There are no specific blogs for O-GlcNAcase/OGA/MGEA5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our O-GlcNAcase/OGA/MGEA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OGA