SLBP Antibody - BSA Free

Western Blot: SLBP Antibody [NBP1-83290] - Analysis using Anti-SLBP antibody NBP1-83290 (A) shows similar pattern to independent antibody NBP2-56007 (B).

Immunohistochemistry-Paraffin: SLBP Antibody [NBP1-83290] - Staining in human testis and pancreas tissues using NBP1-83290 antibody. Corresponding SLBP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SLBP Antibody [NBP1-83290] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: SLBP Antibody [NBP1-83290] - Staining of human rectum shows strong nuclear/cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SLBP Antibody [NBP1-83290] - Staining of human testis shows strong nuclear/cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SLBP Antibody [NBP1-83290] - Staining of human tonsil shows strong nuclear/cytoplasmic positivity in germinal center cells.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLBP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CDGDASFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTI
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLBP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLBP Protein (NBP1-83290PEP)

Reactivity Notes

Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLBP Antibody - BSA Free

• histone binding protein
• histone RNA hairpin-binding protein
• histone stem-loop binding protein
• Histone stem-loop-binding protein
• histone
• stem-loop binding protein

Background

SLBP encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLBP